#protein asks

CaccvccvavcccvvvvvvvvcavecavmqqqqWqqqnqqqqqqnqqqqnqqqqqqqqqqqnqqndqnqqqqmwqQnqnqqmadaccvdvsvvvvvadvqcvvqsqsvdvqvqvvsssssddssvssvncsvsssvvvvcscsvvdvdvfsvfvvvfvfvfvvvfvvvffvvvvfvvvvvvvfvfvvvfvvvfvvvvvffvfvvfvfvfvfvvvvvvvfvvvvvffvfvfvvvfvvvvfvvffvvffvvvvvvvvfvvvvvvvvvfvvvfvvvfvvvvvvfvfvvvvfvvvvvvvvvvvfvvfvvvvvvfvvvvvvffvfvvvvvvvvvvvfvvvfvvvfvvvvvvvvvfvvvvfvvvvfvvvvfvfvffvvvvfvvfvfvvvvvfvfvfvvvvvvfvvvfvvfvvvvvvvvffvvvvfvfvfvfvfvvfvvfvvvvvvvvvvfvvfvvvvvvvfvfvvvvvvfvvvvvffvfvfvvvvvvvvfvvvvfvvvvvfvfvffvfvfvfvvvvfvfvvvvvvvvfvvffvfvvfvfvvfvvvvfvvvfvvfvvffvfvvvvfvvvfvvvfvvvvvvfvfvvfvfvvvvvvvfvfvvfvfvfvfvvfvfvvvffvvfvvfvvfvfvvvvvfvfvvffvvfvfvvfvvfvfscfvdnwmfnnvvvvvvvvvvvvvqwwvnwvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvaccsce Very curious because of all the repeating letters, since you said something about the human language not making good proteins. Maybe this will? Or maybe it won't. Either way, thank you and I hope you have a nice day :)

i have no idea how this is gonna turn out, but i'm sure it will be bad. it still looks better than all the weird shortcuts my cat ends up accidentally clicking whenever he steps on my keyboard. thanks for sharing:)

letter sequence in this ask matching protein-coding amino acids:

CaccvccvavcccvvvvvvvvcavecavmqqqqWqqqnqqqqqqnqqqqnqqqqqqqqqqqnqqndqnqqqqmwqQnqnqqmadaccvdvsvvvvvadvqcvvqsqsvdvqvqvvsssssddssvssvncsvsssvvvvcscsvvdvdvfsvfvvvfvfvfvvvfvvvffvvvvfvvvvvvvfvfvvvfvvvfvvvvvffvfvvfvfvfvfvvvvvvvfvvvvvffvfvfvvvfvvvvfvvffvvffvvvvvvvvfvvvvvvvvvfvvvfvvvfvvvvvvfvfvvvvfvvvvvvvvvvvfvvfvvvvvvfvvvvvvffvfvvvvvvvvvvvfvvvfvvvfvvvvvvvvvfvvvvfvvvvfvvvvfvfvffvvvvfvvfvfvvvvvfvfvfvvvvvvfvvvfvvfvvvvvvvvffvvvvfvfvfvfvfvvfvvfvvvvvvvvvvfvvfvvvvvvvfvfvvvvvvfvvvvvffvfvfvvvvvvvvfvvvvfvvvvvfvfvffvfvfvfvvvvfvfvvvvvvvvfvvffvfvvfvfvvfvvvvfvvvfvvfvvffvfvvvvfvvvfvvvfvvvvvvfvfvvfvfvvvvvvvfvfvvfvfvfvfvvfvfvvvffvvfvvfvvfvfvvvvvfvfvvffvvfvfvvfvvfvfscfvdnwmfnnvvvvvvvvvvvvvqwwvnwvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvaccsce

protein guy analysis:

okay well that's not what i expected! we've got some very long helices, with high confidence scores. i assume that these residues correspond to ones typically found a lot in helices, and the software just didn't know enough to think about how long a helix tends to be. i mean there are some proteins with long alpha helices, but this is a lot. it looks neat though

predicted protein structure:

cartoon representation

oops sorry i've been gone a while! things have been kinda crazy the last few months (my previous lab was rushing to put out a paper including some of my old data from undergrad, i had some work-related travel and i also absolutely obliterated the screen of my computer by dropping it ://)

things are a lot calmer now (or at least they should be!) and i want to try and put out at least a couple posts each week, but yeahhh ik i've been super inconsistent

letter sequence in this ask matching protein-coding amino acids:

PDATE

protein guy analysis:

i think calling this one a protein is a bit of a stretch. it's 5 amino acids. this is a little peptide. sure, the confidence is great, but its also small enough that its perfectly reasonable to draw it as a line bond structure, and this actually makes more sense than a cartoon representation. i'll show you both versions though!

predicted protein structure:

line bond structure

sure thing! I don't really know any of the fnaf lore, but i have a friend who's into it and made a bunch of us take fnaf personality quizzes the other day

letter sequence in this ask matching protein-coding amino acids:

HellHellhellhhIwantedtrecrdamessagefrythelpygetsettledinnyrfirstnightmIactallywrkedinthatfficeefreyImfinishingpmylastweeknwasamatterffactsIknwitcaneaitverwhelmingtImherettellytheresnthingtwrryathylldfineSletsstfcsngettingythrghyrfirstweekkayhletsseeFirsttheresanintrdctrygreetingfrmthecmpanythatImsppsedtreadEhitskindfalegalthingyknwmWelcmetFreddyFaearsPiaamagicalplacefrkidsandgrwnpsalikewherefantasyandfncmetlifeFaearEntertainmentisntrespnsilefrdamagetprpertyrpersnpndiscveryfdamagerifdeathhasccrredamissingpersnsreprtwillefiledwithinninetydaysrassnasprpertyandpremiseshaveeenthrghlycleanedandleachedandthecarpetshaveeenreplacedlahlahlahNwthatmightsndadIknwttheresreallynthingtwrryaththeanimatrniccharactersheredgetaitqirkyatnighttdIlamethemNIfIwerefrcedtsingthsesamestpidsngsfrtwentyyearsandInevergtaathIdpralyeaitirritaleatnighttSrememerthesecharactershldaspecialplaceintheheartsfchildrenandyneedtshwthemalittlerespectRightkaySsteawarethecharactersdtendtwanderaithhtheyreleftinsmekindffreeramingmdeatnighthhsmethingattheirservslckingpiftheygettrnedfffrtlnghhtheysedteallwedtwalkarnddringthedayttthentherewastheitefYeahIItsamaingthatthehmandycanlivewithtthefrntalleyknwNwcncerningyrsafetythenlyrealrisktyasanightwatchmanhereifanyisthefactthatthesecharactershhiftheyhappentseeyafterhrspralywntrecgnieyasapersnThTheyllmstlikelyseeyasametalendskeletnwithtitscstmenNwsincethatsagainsttherleshereatFreddyFaearsPiatheyllpralytrytfrcefllystffyinsideaFreddyFaearsitmnwthatwldntesadifthesitsthemselveswerentfilledwithcrsseamswiresandanimatrnicdevicesespeciallyarndthefacialareaSycanimaginehwhavingyrheadfrcefllypressedinsidenefthsecldcaseaitfdiscmfrtanddeathhthenlypartsfythatwldlikelyseethelightfdayagainwldeyreyeallsandteethwhentheypptthefrntfthemaskhehYYeahtheydnttellythesethingswhenysignptheyFirstdayshldeareeeIllchatwithytmrrwhhcheckthsecamerasandrememertclsethedrsnlyifasltelynecessaryGttacnservepwerAlrightGdnight

protein guy analysis:

this one has a lot of twists and turns with its largely helical structure. there are a few big gaps that would be out of place on an otherwise globular protein, but if you really squint this could probably just about be mistaken for a natural, evolved protein

predicted protein structure:

no i have not, and i'm very curious to see what a string of alanines gives us

letter sequence in this ask matching protein-coding amino acids:

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

protein guy analysis:

aaaannddd its awful! i guess i shouldn't be surprised, but we still always hate to see a box of a beta sheet. i mean to be fair, something made all of hydrophobic amino acids is bound to be working hard to try and keep those side chains sheltered. this makes me wonder how bad something made of all the same amino acid would look for an even more hydrophobic (or even aromatic) amino acid

predicted protein structure:

AccrdingtallknwnlawsfaviatinthereisnwayaeeshldealetflyItswingsaretsmalltgetitsfatlittledyffthegrndTheeefcrsefliesanywayecaseeesdntcarewhathmansthinkisimpssileYellwlackYellwlackYellwlackYellwlackhlackandyellwLetsshakeitpalittlearryreakfastisreadyCmingHangnasecndHellarryAdamCanyelievethisishappeningIcantIllpickypLkingsharpsethestairsYrfatherpaidgdmneyfrthseSrryImecitedHeresthegradateWereveryprdfysnAperfectreprtcardallsVeryprdMaIgtathingginghereYgtlintnyrfwThatsmeWavetsWelleinrwyearryItldystpflyinginthehseHeyAdamHeyarryIsthatfgelAlittleSpecialdaygradatinNeverthghtIdmakeitThreedaysgradeschlthreedayshighschlThsewereawkwardThreedayscllegeImgladItkadayandhitchhikedarndthehiveYdidcmeackdifferentHiarryArtiegrwingamstacheLksgdHearatFrankieYeahYgingtthefneralNImntgingEverydyknwsstingsmeneydieDntwasteitnasqirrelSchahtheadIgesshecldhavestgttentfthewayIlvethisincrpratinganamsementparkintrdayThatswhywedntneedvacatinsyqiteaitfpmpnderthecircmstancesWellAdamtdaywearemenWeareeemenAmenHallelahStdentsfacltydistingishedeespleasewelcmeDeanwellWelcmeNewHiveCitygradatingclassfThatcncldesrceremniesAndeginsyrcareeratHneIndstriesWillwepickrtdayIhearditsstrientatinHeadspHerewegKeepyrhandsandantennasinsidethetramatalltimesWnderwhatitllelikeAlittlescaryWelcmetHneadivisinfHnescandapartftheHeagnGrpThisisitWwWwWeknwthatyasaeehavewrkedyrwhlelifetgettthepintwhereycanwrkfryrwhlelifeHneyeginswhenrvaliantPllencksringthenectartthehivertpsecretfrmlaisatmaticallyclrcrrectedscentadstedandlecntredintthissthingsweetsyrpwithitsdistinctivegldenglwyknwasHneyThatgirlwashtShesmycsinSheisYeswereallcsinsRightYrerightAtHnewecnstantlystrivetimprveeveryaspectfeeeistenceTheseeesarestresstestinganewhelmettechnlgyWhatdythinkhemakesNtenghHerewehaverlatestadvancementtheKrelmanWhatdesthatdCatchesthatlittlestrandfhneythathangsafterypritSavessmillinsCananynewrkntheKrelmanfcrseMsteesaresmallnesteesknwthateverysmallifitsdnewellmeansalttchsecarefllyecaseyllstayintheypickfrtherestfyrlifeThesametherestfyrlifeIdidntknwthatWhatsthedifferenceYllehappytknwthateesasaspecieshaventhadnedayffinmillinyearsSyllstwrkstdeathWellsretryWwThatlewmymindWhatsthedifferenceHwcanysaythatnefreverThatsaninsanechicethavetmakeImrelievedNwwenlyhavetmakenedecisininlifetAdamhwcldtheyneverhavetldsthatWhywldyqestinanythingWereeesWerethemstperfectlyfnctiningscietynEarthYeverthinkmayethingswrkalittletwellhereLikewhatGivemeneeampleIdntknwtyknwwhatImtalkingatPleaseclearthegateRyalNectarFrcenapprachWaitasecndCheckittHeythsearePllencksWwIveneverseenthemthisclseTheyknwwhatitsliketsidethehiveYeahtsmedntcmeackHeycksHicksYgysdidgreatYremnstersYreskyfreaksIlveitIlveitIwnderwheretheywereIdntknwTheirdaysntplannedtsidethehiveflyingwhknwswheredingwhknwswhatYcantstdecideteaPllenckYhaveteredfrthatRightLkThatsmrepllenthanyandIwillseeinalifetimeItsstastatssymleesmaketmchfitPerhapsnlessyrewearingitandtheladiesseeywearingitThseladiesArenttheyrcsinstDistantDistantLkatthesetwCplefHiveHarrysLetshavefnwiththemItmstedangerseingaPllenckYeahnceaearpinnedmeagainstamshrmHehadapawnmythratandwiththetherhewasslappingmehmyIneverthghtIdknckhimtWhatwereydingdringthisTryingtalerttheathritiesIcanatgraphthatAlittlegstyttheretdaywasntitcmradesYeahGstyWerehittingasnflwerpatchsimilesfrmheretmrrwSimileshharryApddlempfrstmayeyrentpfritMayeIamYarentWeregingatGateWhatdythinkyyAreyeeenghImighteItalldependsnwhatmeansHeyHneDadysrprisedmeYdecidewhatyreinterestedinWelltheresaltfchicestynlygetneDyevergetreddingthesameeverydaySnletmetellyatstirringYgrathatstickandystmveitarndandystiritarndYgetyrselfintarhythmItsaeatiflthingYknwDadthemreIthinkatitmayethehneyfieldstisntrightfrmeYwerethinkingfwhatmakingallnanimalsThatsaadfragywithastingeranetyrsnsntsrehewantstginthneyarryyaresfnnysmetimesImnttryingtefnnyYrentfnnyYreginginthneyrsnthestirrerYregnnaeastirrerNneslisteningtmeWaittillyseethesticksIhaveIcldsayanythingrightnwImgnnagetananttattLetspensmehneyandcelerateMayeIllpiercemythraShavemyantennaeShackpwithagrasshpperGetagldtthandcalleverydydawgImsprdWerestartingwrktdayTdaysthedayCmenAllthegdswillegneYeahrightPllencntingstnteepringstirrerfrntdeskhairremvalIsitstillavailaleHa

ngnTwleftnefthemsyrsCngratlatinsSteptthesideWhatdygetPickingcrdtStellarWwCplefnewiesYessirrfirstdayWearereadyMakeyrchiceYwanttgfirstNyghmyWhatsavailaleRestrmattendantspenntfrthereasnythinkAnychancefgettingtheKrelmanSreyrenImsrrytheKrelmanstclsedtWamnkeysalwayspenTheKrelmanpenedpagainWhathappenedAeediedMakesanpeningSeeHesdeadAntherdeadneDeadyDeadifiedTwmredeadDeadfrmtheneckpDeadfrmtheneckdwnThatslifehthisisshardHeatingclingstnteeprerstirrerhmminginspectrnmersevenlintcrdinatrstripespervisrmitewranglerarrywhatdythinkIshldarryarryAllrightwevegtthesnflwerpatchinqadrantnineWhathappenedtyWhereareyImgingtttwherettherehnIhavetefreIgtwrkfrtherestfmylifeYregnnadieYrecrayHellAnthercallcminginIfanynesfeelingravetheresaKreandelinrdthatgetstheirrsestdayHeygysLkatthatIsntthatthekidwesawyesterdayHlditsnflightdecksrestrictedItsKLWeregnnatakehimpReallyFeelinglckyareySignhereherestinitialthatThankyKYgtarainadvisrytdayandasyallknweescanntflyinrainSecareflAsalwayswatchyrrmshckeysticksdgsirdsearsandatsAlsIgtacplefreprtsfrteereingprednsMrphysinahmeecasefitalinglikeacicadaThatsawflAndareminderfryrkieseelawnmerneasltelyntalkingthmansAllrightlanchpsitinslackandyellwHellYreadyfrthishtshtYeahYeahringitnWindcheckAntennaecheckNectarpackcheckWingscheckStingercheckScaredtfmyshrtscheckKladiesletsmveittPndthsepetniasystripedstemsckersAllfydrainthseflwersWwImtIcantelieveImtSleIfeelsfastandfreekiteWwFlwersThisisleLeaderWehaversesvisalringitarnddegreesandhldRsesdegreesrgerringingitarndStandtthesidekidItsgtaitfakickThatisnenectarcllectrEverseepllinatinpclseNsirIpickpsmepllenheresprinkleitverhereMayeadashverthereapinchnthatneSeethatItsalittleitfmagicThatsamaingWhydwedthatThatspllenpwerMrepllenmreflwersmrenectarmrehneyfrsClImpickingpaltfrightyellwCldedaisiesDntweneedthseCpythatvisalWaitneftheseflwersseemstenthemveSayagainYrereprtingamvingflwerAffirmativeThatwasnthelineThisistheclestWhatisitIdntknwtImlvingthisclrItsmellsgdNtlikeaflwertIlikeitYeahfyChemicalyCareflgysItsalittlegrayMysweetlrdfeesCandyraingetfftherePrlemGysThiscldeadAffirmativeVeryclseGnnahrtMamaslittleyYarewaytfpsitinrkieCminginatylikeamissileHelpmeIdntthinktheseareflwersShldwetellhimIthinkheknwsWhatisthisMatchpintYcanstartpackingphneyecaseyreatteatitYwserGrssTheresaeeinthecarDsmethingImdrivingHieeHesackhereHesgingtstingmeNdymveIfydntmvehewntstingyFreeeHelinkedSprayhimGrannyWhatareydingWwthetensinlevelthereisnelievaleIgttagethmeCantflyinrainCantflyinrainCantflyinrainMaydayMaydayeegingdwnKencldyclsethewindwpleaseKencldyclsethewindwpleaseChecktmynewresmeImadeitintafldtrchreYseeFldsthnMrehmansIdntneedthisWhatwasthatMayethistimeThistimeThistimeThistimeThistimeThisDrapesThatisdialicalItsfantasticItsgtallmyspecialskillsevenmytptenfavritemviesWhatsnmerneStarWarsNahIdntgfrthatkindfstffNwnderweshldnttalktthemTheyretftheirmindsWhenIleaveainterviewtheyreflaergastedcantelievewhatIsayTheresthesnMayethatsawaytIdntrememerthesnhavingaignitIpredictedglalwarmingIcldfeelitgettinghtterAtfirstIthghtitwasstmeWaitStpeeStandackThesearewintertsWaitDntkillhimYknwImallergictthemThisthingcldkillmeWhydeshislifehavelessvalethanyrsWhydeshislifehaveanylessvalethanmineIsthatyrstatementImstsayingalllifehasvaleYdntknwwhathescapaleffeelingMyrchreThereyglittlegyImntscaredfhimItsanallergicthingPtthatnyrresmerchreMywhlefacecldpffpMakeitnefyrspecialskillsKnckingsmenetisalsaspecialskillRightyeVanessaThanksVanessanetweekYgrtnightSreKenYknwwhateverYcldptcarchipsnthereyeSppsedtelesscalriesyeIgttasaysmethingShesavedmylifeIgttasaysmethingAllrighthereitgesNahWhatwldIsayIcldreallygetintrleItsaeelawYrentsppsedttalktahmanIcantelieveImdingthisIvegtthIcantditCmenNYesNDitIcantHwshldIstartitYlikeaNthatsngdHereshecmesSpeakyflHiImsrryYretalkingYesIknwYretalkingImssrryNitsKItsfineIknwImdreamingtIdntrecallgingtedWellImsrethisisverydiscncertingThisisaitfasrprisetmeImeanyreaeeIamAndImntsppsedtedingthisttheywerealltryingtkillmeAndifitwasntfryIhadtthankyItssthwIwasraisedThatwasalittleweirdImtalkingwithaeeYeahImtalkingtaeeAndtheeeistalkingtmeIstwanttsayImgrateflIllleavenwWaitHwdidylearntdthatWhatThetalkingthingSamewayydidIgessMamaDadahneyYpickitpThatsveryfnnyY

eaheesarefnnyIfwedidntlaghwedcrywithwhatwehavetdealwithAnywayCanIgetysmethingLikewhatIdntknwImeanIdntknwCffeeIdntwanttptytItsntrleIttakestwmintesItsstcffeeIhatetimpseDnteridiclsActallyIwldlveacpHeyywantrmcakeIshldntHavesmeNIcantCmenImtryingtlseacplemicrgramsWhereThesestripesdnthelpYlkgreatIdntknwifyknwanythingatfashinAreyallrightNHesmakingthetieinthecaastheyreflyingpMadisnHefinallygetsthereHernspthestepsintthechrchTheweddingisnAndhesaysWatermelnIthghtysaidGatemalanWhywldImarryawatermelnIsthataeekeThatsthekindfstffwedYeahdifferentSwhatareygnnadarryAtwrkIdntknwIwanttdmypartfrthehivetIcantditthewaytheywantIknwhwyfeelYdSreMyparentswantedmetealawyerradctrtIwantedteaflristReallyMynlyinterestisflwersrnewqeenwasstelectedwiththatsamecampaignslganAnywayifylkTheresmyhiverightthereSeeitYreinSheepMeadwYesImrightfftheTrtlePndNwayIknwthatareaIlstateringtherenceWhydgirlsptringsntheirtesWhyntItslikepttingahatnyrkneeMayeIlltrythatYallrightmaamhyeahFinesthavingtwcpsfcffeeAnywaythishaseengreatThanksfrthecffeeYeahitsntrleSrryIcldntfinishitIfIdidIdeptherestfmylifeAreyCanItakeapiecefthiswithmeSreHerehaveacrmThanksYeahAllrightWellthenIgessIllseeyarndrntKarryAndthankysmchagainfrefrehthatThatwasnthingWellntnthingtAnywayThiscantpssilywrkHesallsettgWemayaswelltryitKDavepllthechteSndsamaingItwasamaingItwasthescariesthappiestmmentfmylifeHmansIcantelieveywerewithhmansGiantscaryhmansWhatweretheylikeHgeandcrayTheytalkcrayTheyeatcraygiantthingsTheydrivecrayDtheytryandkillylikenTVSmefthemtsmefthemdntHwdygetackPdleYdiditandImgladYsawwhateverywantedtseeYhadyreperienceNwycanpicktyrandenrmalWellWellWellImetsmeneYdidWassheeeishAwaspYrparentswillkillyNnnntawaspSpiderImntattractedtspidersIknwitsthehttestthingwiththeeightlegsandallIcantgetythatfaceSwhissheSheshmanNnThatsaeelawYwldntreakaeelawHernamesVanessahyShessniceAndshesaflristhnYredatingahmanflristWerentdatingYreflyingtsidethehivetalkingthmansthatattackrhmeswithpwerwashersandMsneeighthastickfdynamiteShesavedmylifeAndshenderstandsmeThisisverEatthisThisisntverWhatwasthatTheycallitacrmItwassstinginstripeyAndthatsntwhattheyeatThatswhatfallsffwhattheyeatYknwwhataCinnanisNItsreadandcinnamnandfrstingTheyheatitpSitdwnreallyhtListentmeWearentthemWeresTheressandtheresthemYestwhcandenytheheartthatisyearningTheresnyearningStpyearningListentmeYhavegttstartthinkingeemyfriendThinkingeeThinkingeeThinkingeeThinkingeeThinkingeeThinkingeeThinkingeeThereheisHesintheplYknwwhatyrprlemisarryIgttastartthinkingeeHwmchlngerwillthisgnItseenthreedaysWhyarentywrkingIvegtaltfiglifedecisinstthinkatWhatlifeYhavenlifeYhavenYrearelyaeeWlditkillytmakealittlehneyarrycmetYrfatherstalkingtyMartinwldytalkthimarryImtalkingtyYcmingGteverythingAllsetGaheadIllcatchpDntetlngWatchthisVanessaWerestillhereItldynttyellathimHedesntrespndtyellingThenwhyyellatmeecaseydntlistenImntlisteningtthisSrryIvegttagWhereareygingImmeetingafriendAgirlIsthiswhyycantdecideyeIsthpesheseeishTheyhaveahgeparadefflwerseveryyearinPasadenaTeintheTrnamentfRsesthatseveryflristsdreampnaflatsrrndedyflwerscrwdscheeringAtrnamentDthersescmpeteinathleticeventsNAllrightIvegtneHwcmeydntflyeverywhereItsehastingWhydntyrneverywhereItsfasterYeahKIseeIseeAllrightyrtrnTiVYcanstfreeeliveTVThatsinsaneYdnthavethatWehaveHivtitsadiseaseItsahrrilehrrilediseasehmyDmeesYmstwanttstingallthseerksWetrynttstingItssallyfatalfrsSyhavetwatchyrtemperVerycarefllyYkickawalltakeawalkwriteanangryletterandthrwittWrkthrghitlikeanyemtinAngerealsylsthmygdnessAreyKYeahWhatiswrngwithyItsagHesnttheringanydyGettfhereycreepWhatwasthatAPicNSavecirclarYeahitwasHwdidyknwItfeltlikeatpagesSeventyfiveisprettymchrlimitYvereallygtthatdwntascienceIlstacsintItalianVgeIlletWhatinthenamefMightyHerclesisthisHwdidthisgethereCteeeGldenlssmRayLittaPrivateSelectIshethatactrIneverheardfhimWhyisthishereFrpepleWeeatitYdnthaveenghfdfyrwnWellyesHwdygetiteesmakeitIknwwhmakesitAnditshardtmakeitTheresheatingclingstirringYneedawhleKrelmanthingItsrganicItsrganicItssthneyarrystwhateesdntknwatthisThisisstealingAltfstealingYvetakenrhmesschlshspitalsThisisallwehaveAnditsnsaleImgettingtthettmfthisImgettingtthettmfallfthisHeyHectrYalmstdneAlmstHeishereIse

nseitWellIgessIllghmenwandstleavethisnicehneytwithnnearndYrestedyIknewIheardsmethingSycantalkIcantalkAndnwyllstarttalkingWhereygettingthesweetstffWhsyrspplierIdntnderstandIthghtwewerefriendsThelastthingwewanttdispseteesYretlateItsrsnwYsirhavecrssedthewrngswrdYsirwillelnchfrmyiganaIgnaciWhereisthehneycmingfrmTellmewhereHneyFarmsItcmesfrmHneyFarmsCraypersnWhathrrilethinghashappenedhereThesefacestheyneverknewwhathitthemAndnwtheyrentheradtnwherestkeepstillWhatYrentdeadDIlkdeadTheywillwipeanythingthatmvesWhereyheadedTHneyFarmsIamntsmethinghgehereImgingtAlaskaMseldcraystfflwsyrheadffImgingtTacmaAndyHereallyisdeadAllrighthhWhatisthathnAwiperTripleladeTripleladempnItsyrnlychanceeeWhydeseverythinghavetesdggnecleanHwmchdypepleneedtseepenyreyesStickyrheadtthewindwFrmNPRNewsinWashingtnImCarlKaselltdntkillnmregseeMseldgyYhearsmethingLikewhatLiketinyscreamingTrnfftheradiWhasspeeyHeyldstarwfhneyarsasfarastheeyecldseeWwIassmewhereverthistrckgesiswheretheyregettingitImeanthathneysrseeshangtightWereallammedinItsaclsecmmnityNtsmanWenrwnEverymsqitnhiswnWhatifygetintrleYamsqityintrleNdylikessTheystsmackSeeamsqitsmacksmackAtleastyretinthewrldYmstmeetgirlsMsqitgirlstryttradepgetwithamthdragnflyMsqitgirldntwantnmsqitYgttekiddingmeMseldsattleavetheildingSlngeeHeygysMseldIknewIdcatchyalldwnhereDidyringyrcraystrawWethrwitinarsslapalaelnitanditsprettymchpreprfitWhatisthisplaceAeesgtarainthesiefapinheadTheyarepinheadsPinheadChecktthenewsmkerhsweetThatstheneywantTheThmasSmkerNinetypffsamintesemiatmaticTwicethenictineallthetarAcplereathsfthiskncksthemrighttTheymakethehneyandwemakethemneyTheymakethehneyandwemakethemneyhmyWhatsgingnAreyKYeahItdesntlasttlngDyknwyreinafakehivewithfakewallsrqeenwasmvedhereWehadnchiceThisisyrqeenThatsamaninwmensclthesThatsadragqeenWhatisthishnThereshndredsfthemeehneyrhneyiseingraenlystlennamassivescaleThisiswrsethananythingearshavedneIintendtdsmethingharrystpWhtldyhmansaretakingrhneyThatsarmrDtheselklikermrsThatsacnspiracytheryThesearevislydctredphtsHwdidygetmiedpinthisHeseentalkingthmansWhatTalkingthmansHehasahmangirlfriendAndtheymaketMaketarryWedntYwishycldWhsesideareynTheeesIdatedacricketnceinSanAntniThsecraylegskeptmepallnightarrythisiswhatywanttdwithyrlifeIwanttditfrallrlivesNdywrksharderthaneesDadIrememerycminghmesverwrkedyrhandswerestillstirringYcldntstpIrememerthatWhatrightdtheyhavetrhneyWeliventwcpsayearTheyptitinlipalmfrnreasnwhatseverEvenifitstrewhatcanneeedStingthemwhereitreallyhrtsInthefaceTheeyeThatwldhrtNpthenseThatsakillerTheresnlyneplaceycanstingthehmansneplacewhereitmattersHiveatFivethehivesnlyfllhractinnewssrceNmreeeeardsWithmleattheanchrdeskWeatherwithStrmStingerSprtswithLarviAndeanetteChngGdeveningImmleAndImeanetteChngAtricntyeearryensnintendstsethehmanracefrstealingrhneypackagingitandprfitingfrmitillegallyTmrrwnightneeLarryKingwellhavethreefrmerqeenshereinrstdidiscssingtheirnewkClassyLadiestthisweeknHeagnTnightweretalkingtarryensnDidyeverthinkImakidfrmthehiveIcantdthiseeshavenevereenafraidtchangethewrldWhatateeClmseeGandhieeessWhereImfrmwedneversehmansWewerethinkingfstickallrcandystresHwldareyTheeecmmnityisspprtingyinthiscasewhichwillethetrialftheeecentryYknwtheyhaveaLarryKinginthehmanwrldtItsacmmnnameNetweekHelkslikeyandhasashwandsspendersandclreddtsNetweekGlassesqtesnthettmfrmthegesteventhghystheardemearWeeknetweekTheyrescaryhairyandhereliveAlwaysleansfrwardpintyshlderssqintyeyesveryewishIntennisyattackatthepintfweaknessItwasmygrandmtherKenShesHneyherackhandsakeImntgnnatakeadvantagefthatQietpleaseActalwrkgingnhereIsthatthatsameeeYesitisImhelpinghimsethehmanraceHellHelleeThisisKenYeahIrememeryTimerlandsietenandahalfViramsleIelieveWhydeshetalkagainListenyettergcasewerereallysywrkingtitsrygrtnightyeyeWhyisygrtnightsdifficltYprthingYtwhaveeenatthisfrhrsYesandAdamherehaseenahgehelpFrstingHwmanysgarsstneItrynttsethecmpetitinSwhyareyhelpingmeeeshavegdqalitiesAndittakesmymindfftheshpInsteadfflwerspeplearegivingallnqetsnwThsearegreatifyrethreeAndartificialflwershthsestgetmepsychticYeahmetentstingerspintlesspllinatineesmsthatethsefakethingsNthingwrsethanadaffdilthatshadwrkdneMayethiscldmakepfritalittleitThisla

wsitsaprettyigdealIgessYsreywanttgthrghwithitAmIsreWhenImdnewiththehmanstheywntealetsayHneyImhmewithtpayingaryaltyItsanincredilescenehereindwntwnManhattanwherethewrldanislywaitsecasefrthefirsttimeinhistrywewillhearfrrselvesifahneyeecanactallyspeakWhathavewegttenintherearryItsprettyigisntitIcantelievehwmanyhmansdntwrkdringthedayYthinkillindllarmltinatinalfdcmpanieshavegdlawyersEverydyneedststayehindthearricadeWhatsthematterIdntknwIstgtachillWellifitisnttheeeteamYyswrknthisAllriseTheHnraledgemletnpresidingAllrightCasenmerSperirCrtfNewYrkarryeeensnvtheHneyIndstryisnwinsessinMrMntgmeryyrerepresentingthefivefdcmpaniescllectivelyAprivilegeMrensnyrerepresentingalltheeesfthewrldImkiddingYesYrHnrwerereadytprceedMrMntgmeryyrpeningstatementpleaseLadiesandgentlemenftherymygrandmtherwasasimplewmanrnnafarmsheelieveditwasmansdivinerighttenefitfrmthentyfnatreGdptefresIfwelivedinthetpsytrvywrldMrensnimaginesstthinkfwhatwlditmeanIwldhavetnegtiatewiththesilkwrmfrtheelasticinmyritchesTalkingeeHwdweknwthisisntsmesrtfhlgraphicmtinpictrecaptreHllywdwiardryTheycldesinglasereamsRticsVentrilqismClningFrallweknwhecldensteridsMrensnLadiesandgentlementheresntrickeryhereImstanrdinaryeeHneysprettyimprtanttmeItsimprtanttalleesWeinventeditWemakeitAndweprtectitwithrlivesnfrtnatelytherearesmepepleinthisrmwhthinktheycantakeitfrmscasewerethelittlegysImhpingthatafterthisisallveryllseehwytakingrhneyyntnlytakeeverythingwehaveteverythingweareIwishheddresslikethatallthetimeSniceCallyrfirstwitnessSMrKlassVanderhaydenfHneyFarmsigcmpanyyhaveIsppsesIseeyalswnHneyrtnandHnrnYestheyprvideeekeepersfrrfarmseekeeperIfindthatteaverydistringtermIdntimagineyemplyanyeefreeersdyNIcldnthearyNNecaseydntfreeeesYkeepeesNtnlythatitseemsythghtaearwldeanapprpriateimagefraarfhneyTheyreverylvalecreatresYgiearFieearildAearYmeanlikethisearskilleesHwdylikehisheadcrashingthrghyrlivingrmitingintyrcchSpittingtyrthrwpillwsKthatsenghTakehimawaySMrStingthankyfreinghereYrnameintrigesmeWherehaveIhearditefreIwaswithaandcalledThePlicetyvenevereenaplicefficerhaveyNIhaventNyhaventAndsherewehaveyetanthereamplefeecltrecasallystlenyahmanfrnthingmrethanapranceatstagenamehpleaseHaveyevereenstngMrStingecaseImfeelingalittlestngStingrshldIsayMrGrdnMSmnerThatsnthisrealnameYiditsMrLittafirstelatedcngratlatinsnyrEmmywinfragestsptnERinThankyThankyIseefrmyrresmethatyredevilishlyhandsmewithachrninginnertrmilthatsreadytlwIenywhatIdIsthatacrimeNtyetitisnttisthiswhatitscmetfryEplitingtinyhelplesseessydnthavetrehearseyrpartandlearnyrlinessirWatchitensnIcldlwrightnwThisisntagdfellaThisisaadfellaWhydesntsmeneststepnthiscreepandwecanallghmerderinthiscrtYreallthinkingitrderrderIsaySayitMrLittapleasesitdwnIthinkitwasawfllynicefthateartpitchinlikethatIthinktherysnrsideArewedingeverythingrightlegallyImaflristRightWellherestagreatteamTagreatteamWellhellKenHellIdidntthinkywerecmingNIwasstlateItriedtcallttheatteryIdidntwantallthistgtwastesIcalledarryLckilyhewasfreehthatwaslckyTheresalittleleftIcldheatitpYeahheatitpsrewhateverSIhearyreqiteatennisplayerImntmchfrthegamemyselfTheallsalittlegrayThatswhereIsallysitRightthereKenarrywaslkingatyrresmeandheagreedwithmethateatingwithchpsticksisntreallyaspecialskillYthinkIdntseewhatyredingIknwhwharditistfindtherightWehavethatincmmnDweeeshavepercentemplymenttwedsliketakingthecrdtThatsstwhatIwasthinkingatdingKenIletarryrrwyrrarfrhisfIhpethatwasallrightImgingtdraintheldstingerYeahydthatLkatthatYknwIvestathaditwithyrlittlemindgamesWhatsthatItalianVgeMammamiathatsaltfpagesAltfadsRememerwhatVansaidwhyisyrlifemrevalalethanmineFnnyIstcantseemtrecallthatIthinksmethingstinksinhereIlvethesmellfflwersHwdylikethesmellfflamesNtasmchWatergNttakingsidesKenImwearingaChapstickhatThisispatheticIvegtissesWellwellwellaryalflshYrelffingAmISrfspddePwaterThatwlisgnarlyEceptfrthsedirtyyellwringsKennethWhatareydingYknwIdntevenlikehneyIdnteatitWeneedttalkHesstalittleeeAndhehappenstethenicesteeIvemetinalngtimeLngtimeWhatareytalkingatAretherethergsinyrlifeNttherearetherthingsggingmeinlifeAndyrenefthemFineTalkingeesnygrtnightMynervesarefriedfrmridingnthisemtinalrllercasterGdyeKenAndfryrinfrmatinIprefersgarfreeartificia

lsweetenersmadeymanImsrryatallthatIknwitsgtanaftertasteIlikeitIalwaysfelttherewassmekindfarrieretweenKenandmeIcldntvercmeithwellAreyKfrthetrialIelieveMrMntgmeryisattfideasWewldliketcallMrarryensneetthestandGdideaYcanreallyseewhyhescnsideredneftheestlawyersYeahLaytnyvegttaweavesmemagicwiththisryritsgnnaeallverDntwrryThenlythingIhavetdttrnthisryarndistremindthemfwhattheydntlikeateesYgtthetweeersAreyallergicnlytlsingsnnlytlsingMrensneeIllaskywhatIthinkwedallliketknwWhateactlyisyrrelatinshiptthatwmanWerefriendsGdfriendsYesHwgdDylivetgetherWaitaminteAreyherlittleedgIveseenaeedcmentaryrtwFrmwhatInderstanddesntyrqeengiveirthtalltheeechildrenYeahtSthsearentyrrealparentsharryYestheyareHldmeackYreanillegitimateeearentyensnHesdenncingeesDntyalldateyrcsinsectinImgingtpincshinthisgyAdamdntItswhathewantshImhithlrdyIamhitrderrderThevenmThevenmiscrsingthrghmyveinsIhaveeenfelledyawingedeastfdestrctinYseeYcanttreatthemlikeeqalsTheyrestripedsavagesStingingsthenlythingtheyknwItstheirwayAdamstaywithmeIcantfeelmylegsWhatangelfmercywillcmefrwardtsckthepisnfrmmyheavingttcksIwillhaverderinthiscrtrderrderpleaseThecasefthehneyeesverssthehmanracetkapintedtrnagainsttheeesyesterdaywhenneftheirlegalteamstngLaytnTMntgmeryHeyddyHeyIstheremchpainYeahIIlewthewhlecasedidntIItdesntmatterWhatmattersisyrealiveYcldhavediedIdeetterffdeadLkatmeTheygtitfrmthecafeteriadwnstairsinatnasandwichLktheresalittlecelerystillnitWhatwasitliketstingsmeneIcanteplainitItwasallAlladrenalineandthenandthenecstasyAllrightYthinkitwasallatrapfcrseImsrryIflewsrightintthisWhatwerewethinkingLkatsWerestacplefgsinthiswrldWhatwillthehmansdtsiftheywinIdntknwIheartheypttherachesinmtelsThatdesntsndsadAdamtheycheckinttheydntcheckthmyCldygetanrsetclsethatwindwWhyThesmkeeesdntsmkeRighteesdntsmkeeesdntsmketsmeeesaresmkingThatsitThatsrcaseItisItsntverGetdressedIvegttagsmewhereGetacktthecrtandstallStallanywayycanAndassmingyvednestepcrrectlyyrereadyfrthetMrFlaymanYesYesYrHnrWhereistherestfyrteamWellYrHnritsinterestingeesaretrainedtflyhaphaardlyandasaresltwedntmakeverygdtimeIactallyheardafnnystryatYrHnrhaventtheseridiclsgstakenpenghfthiscrtsvalaletimeHwmchlngerwillweallwtheseasrdshenaniganstgnTheyhavepresentedncmpellingevidencetspprttheirchargesagainstmyclientswhrnlegitimatesinessesImvefracmpletedismissalfthisentirecaseMrFlaymanImafraidImgingthavetcnsiderMrMntgmerysmtintycantWehaveaterrificcaseWhereisyrprfWhereistheevidenceShwmethesmkinggnHlditYrHnrYwantasmkinggnHereisyrsmkinggnWhatisthatItsaeesmkerWhatthisThisharmlesslittlecntraptinThiscldnthrtaflyletalneaeeLkatwhathashappenedteeswhhavenevereenaskedSmkingrnnIsthiswhatnatreintendedfrsTefrcilyaddictedtsmkemachinesandmanmadewdenslatwrkcampsLivingtrlivesashneyslavestthewhitemanWhatarewegnnadHesplayingthespeciescardLadiesandgentlemenpleasefreetheseeesFreetheeesFreetheeesFreetheeesFreetheeesFreetheeesThecrtfindsinfavrftheeesVanessawewnIknewycldditHighfiveSrryImKYknwwhatthismeansAllthehneywillfinallyelngttheeesNwwewnthavetwrkshardallthetimeThisisannhlyperversinfthealancefnatreensnYllregretthisarryhwmchhneyistthereAllrightneatatimearrywhareywearingMysweaterisRalphLarenandIhavenpantsWhatifMntgmerysrightWhatdymeanWeveeenlivingtheeewayalngtimemillinyearsCngratlatinsnyrvictryWhatwillydemandasasettlementFirstwelldemandacmpleteshtdwnfalleewrkcampsThenwewantackthehneythatwasrsteginwitheverylastdrpWedemandanendttheglrificatinftheearasanythingmrethanafilthysmellyadreathstinkmachineWereallawarefwhattheydinthewdsWaitfrmysignalTakehimtHellhavenasesfrafewhrsthenhellefineAndwewillnlngertlerateeenegativenicknamestitsstapranceatstagenamennecessaryinclsinfhneyingshealthprdctsandladeedahmanteatimesnackgarnishmentsCantreatheringitinysHlditrightthereGdTapitMrwellwestpassedthreecpsandtheresgallnsmrecmingIthinkweneedtshtdwnShtdwnWevenevershtdwnShtdwnhneyprdctinStpmakinghneyTrnyrkeysirWhatdwednwCannnallWereshttinghneyprdctinMissinartArtingpllinatinandnectardetailRetrningtaseAdamywldntelievehwmchhneywasttherehyeahWhatsgingnWhereiseverydyAretheytceleratingTheyrehmeTheydntknwwhattdLayingtsleepinginIheardyrncleCarlwasnhiswaytSanAntniwithacricketAtleastwegtrhneyackSmetimesIthinkswhat

ifhmanslikedrhneyWhwldntItsthegreatestthinginthewrldIwasecitedtepartfmakingitThiswasmynewdeskThiswasmynewIwantedtditreallywellAndnwNwIcantIdntnderstandwhytheyrenthappyIthghttheirliveswldeetterTheyredingnthingItsamaingHneyreallychangespepleYdnthaveanyideawhatsgingndyWhatdidywanttshwmeThisWhathappenedhereThatisntthehalffithnhmyTheyreallwiltingDesntlkverygddesitNAndwhsefaltdythinkthatisYknwImgnnagesseeseesSpecificallymeIdidntthinkeesntneedingtmakehneywldaffectallthesethingsItsntstflwersFritsvegetalestheyallneedeesThatsrwhleSATtestrightthereTakeawayprdcethataffectstheentireanimalkingdmAndthenfcrseThehmanspeciesSiftheresnmrepllinatinitcldallstgsthherecldntitIknwthisisalspartlymyfaltHwatasicidepactHwdweditIllstingyystepnmeThatstkillsytwiceRightrightListenarrysrrytIgttagetgingIhadtpenmymthandtalkVanessaVanessaWhyareyleavingWhereareygingTthefinalTrnamentfRsesparadeinPasadenaTheyvemvedittthisweekendecasealltheflwersaredyingItsthelastchanceIlleverhavetseeitVanessaIstwannasayImsrryInevermeantitttrntlikethisIknwMeneitherTrnamentfRsesRsescantdsprtsWaitaminteRsesRsesRsesVanessaRsesarryRsesareflwersYestheyareFlwerseespllenIknwThatswhythisisthelastparadeMayentCldyaskhimtslwdwnCldyslwdwnarryKImadeahgemistakeThisisattaldisasterallmyfaltYesitkindfisIverinedtheplanetIwantedthelpywiththeflwershpIvemadeitwrseActallyitscmpletelyclseddwnIthghtmayeywereremdelingtIhaveantherideaanditsgreaterthanmyprevisideascminedIdntwantthearitAllrighttheyhavethersestherseshavethepllenIknweveryeeplantandflwerdinthisparkAllwegttadisgetwhattheyvegtackherewithwhatwevegteesParkPllenFlwersRepllinatinAcrssthenatinTrnamentfRsesPasadenaCalifrniaTheyvegtnthingtflwersflatsandcttncandySecritywilletightIhaveanideaVanessalmeFTDfficialflralsinessItsrealSrrymaamNicerchThankyItwasagiftnceinsidewestpicktherightflatHwatThePrincessandthePeaIcldetheprincessandycldethepeaYesIgtitWhereshldIsitWhatareyIelieveImthepeaThepeaItgesnderthemattressesNtinthisfairytalesweetheartImgettingthemarshalYdthatThiswhleparadeisafiascLetsseewhatthisaylldHeywhatareydingThenallwedislendinwithtrafficwithtarsingsspicinnceattheairprttheresnstppingsStpSecrityYandyrinsectpackyrflatYesHasiteeninyrpssessintheentiretimeWldyremveyrshesRemveyrstingerItspartfmeIknwsthavingsmefnEnyyrflightThenifwerelckywellhavestenghpllentdtheCanyelievehwlckyweareWehavestenghpllentdtheIthinkthisisgnnawrkItsgttwrkAttentinpassengersthisisCaptainScttWehaveaitfadweatherinNewYrkItlkslikewelleperienceacplehrsdelayarrythesearectflwerswithnwaterTheyllnevermakeitIgttagetpthereandtalktthemecareflCanIgethelpwiththeSkyMallmagaineIdliketrderthetalkinginflatalenseandearhairtrimmerCaptainIminarealsitatinWhatdysayHalNthingeeDntfreaktMyentirespeciesWhatareydingWaitaminteImanattrneyWhsanattrneyDntmveharryGdafternnpassengersThisisyrcaptainWldaMissVanessalmeinpleasereprttthecckpitAndpleasehrryWhathappenedhereTherewasaDststeratpeealiferaftepldednesaldnesinaattheyrethncnscisIsthatanthereekeNNnesflyingtheplaneThisisFKcntrltwerFlightWhatsyrstatsThisisVanessalmeImaflristfrmNewYrkWheresthepiltHesncnscisandsisthecpiltNtgdDesanynenardhaveflighteperienceAsamatterffactthereisWhsthatarryensnFrmthehneytrialhgreatVanessathisisnthingmrethanaigmetaleeItsgtgiantwingshgeenginesIcantflyaplaneWhyntIsnthnTravltaapiltYesHwhardclditeWaitarryWereheadedintsmelightningThisismleWehavesmelatereakingnewsfrmFKAirprtwhereasspenseflsceneisdevelpingarryensnfreshfrmhislegalvictryThatsarryisattemptingtlandaplaneladedwithpepleflwersandanincapacitatedflightcrewFlwersWehaveastrmintheareaandtwindividalsatthecntrlswithasltelynflighteperiencestaminteTheresaeenthatplaneImqitefamiliarwithMrensnandhisnaccntcmpadresTheyvedneenghdamagetisntheyrnlyhpeTechnicallyaeeshldntealetflyatallTheirwingsaretsmallHaventweheardthisamillintimesThesrfaceareafthewingsanddymassmakensenseGetthisntheairGtitStandyWeregingliveThewaywewrkmayeamysterytyMakinghneytakesaltfeesdingaltfsmallstletmetellyatasmallIfyditwellitmakesaigdifferenceMrethanwerealiedTsteveryneThatswhyIwanttgeteesacktwrkingtgetherThatstheeewayWerentmadefellWegetehindafellwlackandyellwHellLeftrightdwnhverHverFrgethverThisisntshardeepeepeepeeparrywhathap

penedWaitIthinkwewerenatpiltthewhletimeThatmayhaveeenhelpingmeAndnwwerentSittrnstIcanntflyaplaneAllfyletsgetehindthisfellwMveittMvetrnlychanceisifIdwhatIddycpymewiththewingsftheplaneDnthavetyellImntyellingWereinaltftrleItsveryhardtcncentratewiththatpanickytneinyrviceItsntatneImpanickingIcantdthisVanessapllyrselftgetherYhavetsnaptfitYsnaptfitYsnaptfitYsnaptfitYsnaptfitYsnaptfitYsnaptfitYsnaptfitYsnaptfitHlditWhyCmenitsmytrnHwistheplaneflyingIdntknwHellensngtanyflwersfrahappyccasininthereThePllencksTheydgetehindafellwlackandyellwHellAllrightletsdrpthistincannthelacktpWhereIcantseeanythingCanyNnthingItsallcldyCmenYgttthinkeearryThinkingeeThinkingeeThinkingeeThinkingeeThinkingeeWaitaminteIthinkImfeelingsmethingWhatIdntknwItsstrngpllingmeLikeamillinyearldinstinctringthensedwnThinkingeeThinkingeeThinkingeeWhatinthewrldisnthetarmacGetsmelightsnthatThinkingeeThinkingeeThinkingeeVanessaaimfrtheflwerKttheenginesWereginginneepwerReadyysAffirmativeGdGdEasynwThatsitLandnthatflwerReadyFllreverseSpinitarndNtthatflwerThetherneWhichneThatflwerImaimingattheflwerThatsafatgyinaflweredshirtImeanthegiantplsatingflwermadefmillinsfeesPllfrwardNsedwnTailpRtatearnditThisisinsanearryThissthenlywayIknwhwtflyAmIkkkachristhisplaneflyinginaninsectlikepatternGetyrnseinthereDnteafraidSmellitFllreversestdrpiteapartfitAimfrthecenterNwdrpitinDrpitinwmanCmenalreadyarrywediditYtaghtmehwtflyYesNhighfiveRightarryitwrkedDidyseethegiantflwerWhatgiantflwerWherefcrseIsawtheflwerThatwasgenisThankytwerentdneyetListeneveryneThisrnwayiscveredwiththelastpllenfrmthelastflwersavailaleanywherenEarthThatmeansthisisrlastchanceWerethenlyneswhmakehneypllinateflwersanddresslikethisIfweregnnasrviveasaspeciesthisisrmmentWhatdysayArewegingteeesrstMsemfNatralHistrykeychainsWereeesKeychainThenfllwmeEceptKeychainHldnarryHereYveearnedthisYeahImaPllenckAnditsaperfectfitAllIgttadarethesleeveshyeahThatsrarryMmTheeesareackIfanydyneedstmakeacallnwsthetimeIgtafeelingwellewrkinglatetnightHeresyrchangeHaveagreatafternnCanIhelpwhsnetWldylikesmehneywiththatItiseeapprvedDntfrgettheseMilkcreamcheeseitsallmeAndIdntseeanickelSmetimesIstfeellikeapiecefmeatIhadnideaarryImsrryHaveygtammentWldyecsemeMymsqitassciatewillhelpySrryImlateHesalawyertIwasalreadyaldsckingparasiteAllIneededwasariefcaseHaveagreatafternnarryIstgtthishgetliprderandIcantgetthemanywhereNprlemVanniestleaveittmeYrealifesaverarryCanIhelpwhsnetAllrightscramlecksItstimetflyThankyarryThateeislivingmylifeLetitgKennyWhenwillthisnightmareendLetitallgeatifldaytflySreisetweenyandmeIwasdyingtgettfthatfficeYhavegttstartthinkingeemyfriendThinkingeeMeHlditLetsststpfrasecndHlditImsrryImsrryeveryneCanwestphereImntmakingamarlifedecisindringaprdctinnmerAllrightTaketeneverydyWrapitpgysIhadvirtallynrehearsalfrthat

okay i did it! thank you again for your time and efforts

letter sequence in this ask matching protein-coding amino acids:

yeah no i'm not putting all that here again. i'm numbering the parts 1-8 in the above order

protein guy analysis:

parts 1 and 3-6 all look very similar. they're gigantic globular proteins, and with the exception of short loops between them, are composed entirely of alpha helices. easily the most notable thing about these structures is how massive they are – about 450 KDa each. i've gone ahead and put these into rainbow colours to help give some sense of depth. part 2 looks similar to the other blobs, but a lot less tightly compacted, with way more unstructured loops. it's the much more spaghetti-looking version of the others.

part 7 has different spaced out clusters that almost look like independent domains, although i may be biased by the colouring. part 8 is the most different, and is also a fair bit shorter than the others. its most distinct trait is the long sections of antiparallel beta sheets, which always remind me of amyloid fibrils. in case it wasn't clear, i absolutely hate seeing these things. i'd much rather have unstable spaghetti than super stable aggregates. there are three different sections of these beta sheet messes, forming either rectangular or triangular looking disasters.

the one consolation is that no significant part of any of these structures has a confidence score above 50%. or, in other words, even the backbone is uninterpretable and everything you're seeing here is just the mad hallucinations of a computer trying its best

predicted protein structure:

part 1

part 2

part 3

part 4

part 5

part 6

part 7

sure why not?

letter sequence in this ask matching protein-coding amino acids:

lysinehellkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk

protein guy analysis:

in a shocking turn of events, the confidence score on this one is actually good!? i guess it's pretty small and there isn't much to work with. i still don't have any idea how this would act in real life though. there are a lot of lysines, which immediately brought ubiquitination and proteasomal degradation to mind, but ubiquitin ligases work by recognizing a specific motif, and the lysine that they ubiquitinate does not have to be a part of that motif. these motifs are usually short sequences, but are not super well characterized, especially for a lot of cytosolic protein targets. also i was lazy and didn't want to search up if any part of this matches known degron sequences

predicted protein structure:

sure thing!

letter sequence in this ask matching protein-coding amino acids:

dingdngWellSeymrImadeitdespiteyrdirectinsAhSperintendentChalmersWelcmeIhpeyrepreparedfrannfrgettalelnchenyeahgasphegadsMyrastisrinedtwhatifIweretprchasefastfdanddisgiseitasmywnckinghhhhDelightfllydevilishSeymrahintrthemeplaysSkinnerwithhiscrayeplanatinsThesperintendentsgnnaneedhismedicatinwhenyhearSkinnerslameeaggeratinstherelletrleintwntnightSEYMRRRRSperintendentIwassthstretchingmycalvesnthewindwsillIsmetriceercisecaretinmeWhyistheresmkecmingtfyrvenSeymrhthatsntsmkeitssteamSteamedfrmthesteamedclamswerehavingmmmmSteamedclamsPhewSperintendentIhpeyrereadyfrmthwateringhamrgersIthghtwewerehavingsteamedclamshnIsaidsteamedhamsThatswhatIcallhamrgersYcallhamrgerssteamedhamsYesItsareginaldialecthhhWhatreginpstateNewYrkReallyWellimfrmticaandIveneverheardanynesethephrasesteamedhamshntinticanItsanAlanyepressinIseeYknwthesehamrgersareqitesimilartthenestheyhaveatKrstyrgerhhhhhnPatentedSkinnerrgersanldfamilyrecipeFrsteamedhamsYesYesandycallthemsteamedhamsdespitethefactthattheyarevislygrilledyhyknwnethingIshEcsemefrnesecndfcrseAaaaaawellThatwaswnderflGdtimewashadyallImppedYesishldeGDLRDWHATISHAPPENINGINTHEREArrarealisAArrarealisAtthistimefyearAtthistimefdayInthispartfthecntryLcaliedentirelywithinyrkitchenYesMayiseeitNSeymrThehseisnfireNmtheritsstthenrthernlightsWellSeymrImstsayyareanddfellwtysteamagdhamHELPHEEEEELPshrtfiretrcknise

protein guy analysis:

this one is all over the place, with some beta strands, lots of helices and so many disordered loops between it all. it looks like a bit of a mess, but in the same sort of way that most of these large structures look like a mess. so that leaves us with this: a bit of an abstract and confusing structure that probably doesn’t quite hold up to real world physics or chemistry, but is doing its best nonetheless

predicted protein structure:

i'm actually currently a fan of having my hair on my head, but thanks for asking so nicely

letter sequence in this ask matching protein-coding amino acids:

canishaveyrhairandfeedittmypetneighr

protein guy analysis:

unfortunately for my current fight against baldness, alphafold did like this one. the short peptides tend to turn out pretty well most of the time, and a lot of them (including this ask) end up being helical, so i'm not too surprised. i guess there's significantly less structural information to process and predict with only a few dozen residues rather than a few hundred

predicted protein structure: