CHARYBDOTOXIN
https://www.difficultpeptide.com/products/charybdotoxin/
KCa1.1, KV1.2, KV1.3 K+ channels, Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.
 SPECIFICATION OF CHARYBDOTOXIN
Product Name: Charybdotoxin
CAT.#: K1080-V
CAS N0.: 95751-30-7
Sequence: ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid)
Purity: > 98%
Solubility: Soluble in water
Form/State: Lyophilized powder
Molecular weight: 4296 Da
Molecular formula: C176H277N57O55S7
Source: Synthetic peptide
Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Storage of solutions: Up to two weeks at 4°C or three months at -20°C.
 APPLICATION OF CHARYBDOTOXIN
Charybdotoxin (CTX), a peptide from the Leiurus scorpion venom, blocks voltage-gated K(+)-channels












