DEAR READER

tannertan36
Stranger Things
AnasAbdin
he wasn't even looking at me and he found me
NASA
Today's Document

Product Placement

titsay

romaâ

blake kathryn
we're not kids anymore.

if i look back, i am lost

â
Not today Justin
Sade Olutola
RMH

ellievsbear
PUT YOUR BEARD IN MY MOUTH

seen from Malaysia
seen from India

seen from India

seen from TĂźrkiye

seen from United States
seen from United States

seen from Netherlands

seen from United States
seen from Germany
seen from Romania

seen from United Kingdom

seen from United States
seen from United States

seen from Germany
seen from Bulgaria

seen from United States

seen from United Kingdom
seen from Netherlands
seen from Germany
seen from United Kingdom
@sniffimfarts

Anya is live and ready to show you everything. Watch her strip, dance, and perform exclusive shows just for you. Interact in real-time and make your fantasies come true.
Free to watch ⢠No registration required ⢠HD streaming
Camping Fart Slave Training - Part 1
I didn't want to go camping with Joeseph due to not wanting to be in an enclosed space with him for an extended period of time.
We had been friends since school, always around at each other's houses but recently Joeseph started to enjoy teasing me by being gross, farting around or sometimes on me, burping constantly and sometimes making me wake up with his shoe tied to my face.
However, nothing could prepare me for this.
I arrived at the campsite Joeseph stood there, his blonde scruffy hair blowing in the wind and his silky tracksuit bottoms and the tent that didn't look too big.
As I approached I could see the campfire on with a disposable BBQ cooking some burgers and sausages. I went into the tent and set up my side, there wasn't much room in the tent however as I moved something fell out of Joeseph's bag, what looked like a gas mask from the war...
"Mate what the f**k is this?" holding the gas mask in the air, "Oh that's for later don't stress man food ready" Joeseph replied with a beaming smile on his face.
Confused I finished getting sorted and headed out.
It was cold outside so we just sat and quickly ate, the food was lush. Unfortunately, the quiet location wed chosen was ruined by a large rumble in Joesephs belly then a huge fart erupting out of his ass.
He laughed as I companies about the smell, even outside it was putrid. "Don't do that in the tent man we will both die" smiling Joeseph responded, "Oh don't worry I have a solution for that".
I just laughed it off, we chatted some more but then it was too cold to stay out so I headed to the toilet while Joeseph got sorted.
I entered the tent to Joeseph topless, with his tracksuit bottoms still on and no socks, he was laying on top of his sleeping bag and was stroking his dick.
I laid down in my sleeping bag and zipped it up, shortly after a smell started to fill the whole tent, a rancid eggy smell from Joeseph ass.
"F**k man that's rank, you said you weren't gonna do this," I said while choking on the putrid smell that had filled our small tent.
At that very moment Joeseph sat on my chest, looking down at me he smiled and said "Ah yes the solution" he grabbed the gas mask I had seen before holding it up and inspecting it "You see, I want a fart slave full time as my gas has been getting so bad. So I thought you'd make a good candidate"
I started to struggle in the sleeping bag "Mate what?!? Please don't I can't take this anymore" As I finished that sentence Joeseph gagged me with one of his dirty socks. Ensuring I could no longer speak.
He placed the gas mask over my face, making sure it was airtight. He placed his hand over the filter of the gas making me squirm as I couldn't breathe and released it once I reacted "Ah good, no escape".
He then attached a specially fitted hose to the gas mask testing that the same way to ensure it was airtight. He then got off me, on his knees he turned round to show me a zip on the back of his tracksuit bottoms. He unzipped it and attached the other end of the hose to a specially fitted attachment.
The foul smell of his ass shot down the hose and into the mask, filling it within seconds of his musty ass smell.
He then got out some tape and taped it around my sleeping bag meaning I couldn't get out of it, secured into it and secured to his ass. I couldn't even move my hands out of the bag because of his tape.
"Ok, fart sniffer here is what's gonna happen, when we leave this campsite your gonna be under my control forever. You'll want to do nothing but inhale my gas". He said as he stroked my dick.
I thought to myself that it won't happen, how could I love and beg for his farts when they were so disgusting and made me feel ill.
"What I am going to do is make sure that every time I fart I stroke your dick, I want you to think of the pleasure you get down there every time I fart. I am going to make you cum from my gas"
I squirmed again and once tried to reason in my head what was happening. Then it his me, the foul stench, he had farted
I began to squirm from the stench that had begun to fill the mask until the hose started to vibrate and then the sound came to PPFFFRRRTTTTRRRPPPPPPPPPPPPPPPSSSSSSSSSSSSSS
"Oh fuck that felt good," Joespeh said as he laughed loudly "How was that fart sniffer," he said while stoking my dick which was soft.
I was squirming around, the tent shaking. Joseph laughed as he released silent farts continuously into the mask. This was hell.
Camping Fart Slave Training - Part 3 (Final Part)
I woke up mummified inside a sleeping bag and herd chatter outside. One voice was definitely Joeseph and the other ones I donât know who I moved around slightly and Joesephâs face peered into the tent, looking at me âHello again fart slave, Iâve brought some friendsâ two other guys, in full tracksuits looks back at me one smacked his arse as he looked into my eyes.
They all got into the small tent. Once inside Joeseph started rubbing my dick once again âitâs time for your last challenge fart slutâ when I tried to reply all it came out was moans. I slowly realised that the gas mask I was wearing was different to the one before and my mouth had also been gagged with a pair of horrible tasting, dirty socks.
As I looked down as much as I could, I could see three tubes coming from the bottom of the gas mask. This couldnât be good each of the lads grabbed of the tubes and attached it to their arsehole. I began to smell the horrible smell of three arses mixed together, creating a horrible stink, unlike anything I have ever smelt before.
Joseph started to rub the sleep bag, which felt comforting, which is something I needed, knowing what was gonna happen to me. âOk, so youâre gonna take all of our farts until you agree to sign this contractâ. what contract was Joeseph on about? I would never agree to this! I let out a moan shaking my head. Joeseph lent over and looked into my eyes. He started reading the contract.
âPart one, I promise to sniff my masters farts, whenever I am required, and no matter where I am.
Part two if my master has friends round who need to fart, I can be used as a filter for that rancid gas.
Part three, you are not allowed to cum unless you are sniffing farts.
Part four, you promised to move into Joesephâs flat and become his bitch for the rest of your life.â
I shook and disagreement all parts of this contract. I didnât want to accept it. I didnât want to be a fart slave for the rest of my life. I just wanted to be released.
Joeseph moved his hand down to my cock and started rubbing it. He lent back âok boys here we goâ. The first fart ripped down the gas mask tube into my face. All I could do is sniff it I start to moan as the next fart rumbled down the hose, followed by more and more and more gas.
Whilst this was happening, Joeseph was rubbing my cock forcing me to be horny to this extensive torture.
One of the other lads lent over and looked into my eyes. He put his hand on the side of my face and asked me to guess what he had for dinner before releasing a massive stinky fart into the tube. I maoned and shaked as he laughed.
This torture of non-stop farts went on for 10 minutes straight without any break. One of them was always farting. Joeseph lent over me again and said it could be all over if I just signed the contract in my head it was beginning to think like the only option I had for survival.
Soon the three guys stopped, Joseph said to them âI think we need the next stageâ âYes sirâ replied one of the lads.
My gas mask and gag was removed, I could finally breathe somewhat fresh air. Joeseph and the other two guys, then got out a massive sleeping bag. It looked like a triple one. It could fit multiple guys and at once I was told to get into the bottom of it, I refused. Joeseph climbed on me cuffing my hands and my feet and dragged me in.
I was pushed down to the bottom and then the three lads got in the top. Their feet went on my face, which stunk about as bad as their farts. Joeseph reached down to me and attached a collar to my neck. I was now completely enclosed in this Dutch oven.
I felt the collar pulling and I was dragged up to one of the lads ass. He put his hand on the back of my head, and pushed my face into his rancid, bare arse, and proceeded to start farting on my face no matter how much I tried to pull away, I couldnât. When I did manage to get a little bit away from his arse, the smell didnât get any better as the smell was just filling the whole of the sleeping bag.
I was pulled to the next guy who proceeded a fart on my face multiple times and kept on telling me to lick their arse. Eventually, I did as I was told and stick my tongue in. Their arsehole was disgusting. You could taste their farts they had created.
Finally, Joeseph pulled me over to his arse. I could always recognise his gas after all. Iâve taken it for a good few days at this point. Joeseph pulled me with the collar, forced his dick into my mouth and forced me to deep throat him as he released some eggy gas around me. I was now sniffing his rancid farts and sucking his giant dick.
This went on for a good 10 minutes before he came into my mouth. He allowed me to take his dick out of my mouth and pushed me into his arse where he released another few bubbly fart right in my face I felt so submissive. The other guy pulled me over to theirs. Most sat in between them. Both of them sat on my face at once. I had one ass on either sides of my face.
Both of them start releasing eggy farts right onto my nose. I had no escape. I started shaking. I still have to cum from Joesephâs cock dripping out of my mouth as I was forced to endure more gas the inside of the sleeping bag, stank of rancid fart and cum. I shouted out at the top of my voice âIâll sign it, Iâll sign itâ.
And right then too much of disgusting farts hit my face. I start shaking from the stench again, and then I felt the collar pull me back up to the surface.
Joeseph was sat in the tent with the pen in his hand, and the contract on the ground. He gave the pen to me and instructed me to sign it. I nervously signed the contract while making the odd glance to my new master above me. I was now a fart slave for Joeseph.
As soon as I signed the other two lads pulled the colour back into the sleeping bag. Where is one of them sat on my face, ripping farts, the other one put his cock in my mouth and forced me to take more of his cum, and then they switched the other one took over the farting duties, as I had to suck another cock and take more come.
My mouth was dripping. My face stank and my cock was harder than it ever been before. I was now fully a fart slave. I was Joesephâs fast slave.
There was a story that I had reposted about a guy training his roommate to be his fart sniffer, but it got taken down sometime ago. Does anyone have it saved? It was probably my favorite fart fiction
Donât be embarrassed. A fart fag is just what you are. You were born at the bottom, the very bottom haha. Now hurry up and plant your nose in my asshole, Iâm holding a big one back so we can show the rest of the team how good I got you trained.

Anya is live and ready to show you everything. Watch her strip, dance, and perform exclusive shows just for you. Interact in real-time and make your fantasies come true.
Free to watch ⢠No registration required ⢠HD streaming
Part 2 : Drunk roommates having fun
âDuuude that went straight up his nose , it mustâve stunk so bad haha! I can even smell it up here!â Alvis laughed. âHold onâŚI got some more hahaâ Lucas said as I once again felt his ready to rip asshole push against my nose. PFFFFFTTTTTH
"Dude I even felt some of the fart blow onto my hand, itâs that strong!â Alvis started laughing. "How'd you like that one buddy?" Lucas taunted me. âI kinda want to hear him beg..but hell we gotta keep him smelling these up hahaha!â Patrick couldnât help himself but to start cracking up at the thought of it. âOh, we're just getting started, my protein farts are basically endlessâ Lucas laughed.
I tried breathing through my mouth, but it was tightly sealed. I had no choice but to sniff up his farts... and even when I was holding my breath, it wouldn't make much of a difference since his gas was being blasted straight into my nose. With Alvis still holding my head in place, he ripped another big one.... then another... and another. All in the span of about 30 seconds. I felt like I was going to pass out; it was so bad.
I held my breath as he blasted another huge fart that lasted about 5 seconds. Right after it stopped, Lucas said, âNow if you take a big whiff, I'll let you go. Go on, let me hear you smell it."
I reluctantly did as I was told and inhaled loudly through my nose, getting the full effect of the last fart. It smelled terribly, but I just wanted this to finally end.
I started to gag and cough through the tape, and it made the guys howl with laughter. âNow we could let you goâŚor we could keep doing this all night hahaha!â Lucas laughed.
I started to squirm frantically, but they held me down unbothered. âI think he deserves another fart up his nose! Donât you think Lucas?â Alvis smiled as he said. âIâm already there with you dudeâ Lucas said with a smirk.
PPPhhhhhrrrtttt A huge burst of air I felt against my nose. âAahhh you like that? I call that silent but deadly. Oh, I feel another one. Get ready to start sniffing dude.â BBBbbrrppppttt. âAhhh.â Lucas smiled as he said.
Fart after fart wrecked havoc on my poor nose, and all my roommates were doing was laughing. Enjoying my complete humiliation. Basking in the fact that they are the alpha males and Iâm their fart bitch. Finally, Lucas spoke again, all the while releasing a soft stream of gas onto my face. It was warm, and I could feel it blowing into my nose. The stench was pure ass, like dirty sweaty man ass, and I began to gag.
âInhale fag, and Iâll get off your face.â I let out a small whimper not wanting to inhale any of his gas willingly. âI said inhale! Or else your nose will be held against my sweaty crack tonight!â They all laughed.
Immediately following his statement, I began to inhale through my nose to the best of my ability. My willing nose was now bombarded with Lucasâs hot humid heavy farts. During this, I start to feel faint, but I can still manage to hear Lucas saying something along the lines of âAhh yeah thatâs right fag. No farts wasted. Sniff 'em up sissyâ all the while Alvis and Patrick sound like hyenas around me.
âThis is going straight into the football chat!â Alvis said as the recording ended due to a lack of storage. âHey isnât Coach Brawn in there too!?â Patrick suddenly realized.
âHaha itâs fine, knowing him heâll love itâ Alvis simply said as he shared it with the Snapchat group and watched for a moment as some of the guys in the chat started going wild laughing. Alvis then quickly deleted some apps without hesitation and went straight back to recording. I canât miss any more farts! He thought.
âSniff it up piggy!â âOh yeah, get some of thatâ With my nose pressing into Lucasâs asshole, my eyes are still able to see up Lucasâs back. My eyes travel up it, looking at his muscles flex and shine with beads of sweat dripping down to conform in the middle of his backline, sliding down his crack and onto my nose. I look farther up his broad shoulders and see him looking back down at me as he grins. What an asshole! Lucas canât help but smile as he can see Bertâs nose disappear into his crack, and his pleading eyes looking back up at him. Those eyes with tears falling from them over and over, his brow furrowed in suffering as he groans and whines trying to move his face out of his crack but failing to even slightly due to Alvisâs tight grip.
ALVIS POV
Alvis laughed once again as he stares at Lucasâs dirty hole plastered against Bertâs nostrils. He laughs as it pushes against his nose and opens up, letting out a stream of pure ass fart. Alvis grins even more when he gets an idea and puts down the camera for a moment. Using his now free hand, he pinches Bertâs nose.
âI got his nose, when you're ready to fart let me know and Iâll release it, forcing him to start rapidly inhaling. This way heâll be sniffing at the perfect time and get the full amount of stink!â
âHahaha yes dude good idea. Make sure his nostrils are in a good position too; we donât want any of the fart going past his nose!â Lucas laughed as he said.
âFor sure dude hahaâ Alvis said. After about 30 seconds he perked up and exclaimed âOkay, I think I got a big one, ready on three?â âReadyâ âOkay, oneâŚtwoâŚTHREE!â Alvis unpinches his nose and immediately uses one finger to pull back on the top of its tip so that the nostrils are pulled back and fully exposed, then uses his other fingers to pull apart the two sides of Bertâs nose, to fully open his nostrils not only vertically but horizontally as well. Oh yea! Youâre in for it now! Alvis couldnât help but think in blissful anticipation.
BERT POV
Now I actually look like a pig with my nostrils stretched out as wide as they can. I thought the stink was bad before but now it's even worse. Iâve never felt so defenseless and defeated before in my entire life. Iâve never had my nose airway so widened before and now my sense of smell was increased seemingly twofold.
PTFFFFTTFFTFFFFFFF An intense blast of noxious fumes gusts itself continuously straight into my nasal cavity, as I desperately sniff trying to get any oxygen I canâŚbut to my avail only sniffing in pure asshole and shit. I suck every last whiff into my nose as the fart lasts about 8 seconds (one of the biggest farts so far). âOH MY GOD DUDE! Did you hear him huffing it in!! BAHHAHAâ Alvis canât hold himself back from dying of laughter. âHAHAHAHA that mustâve smelled nice huh fag!â I can see Lucas grin down at me as I cry against his hole only to receive another sudden blast in my nostrils, me and Lucas making eye contact as Iâm in disbelief. Why does he enjoy torturing me so much!? What did I do to deserve this?!
Come, faggot. You overcooked my ribeye and there are consequences in this house, my house. I let you live here because you serve and pay most of the rent but tonight you fucked up.
Peel off my dirty socks and wad them both in your mouth, yeah like that. Now get âem nice and clean in there and press your nose to my asshole. Iâm gonna put this blanket over you, itâs getting cold outside and going to enjoy a nice long relaxing movie, just hope I donât fall asleep PpppFfFFfTttttâŚ.. ahhhhh. Breathe nice and deep, you are my fart filter too. As you breathe in my stench, think about how badly you fucked up tonight and how youâll improve tomorrow. Cooking for me is an act of worship for your straight god of a roommate. PRrraaappapppptttâŚ. Enjoy bitch.
Thanks to anonymous for commissioning me!
Smell of the undefeated
I canât believe my boyfriendâs about to fight in an underground wrestling league. My boyfriend, David, has never wrestled in his life but is a huge fan of pro-wrestling. All David has going for him is that heâs fit.
Weâre in a ring, located in the center of a supposedly abandoned warehouse, with hundreds of people in the stands surrounding us.  Â
The reason this is held in a fake abandoned warehouse is because this league is illegal. Bets are openly taken for every match and a wrestler killing their opponent is fine. The staff will take care of the body after the match. And unfortunately we learned that David will be taking on the champion, and heâs known for killing rookies like David.
Iâm standing on the outside of the ropes, next to David, whoâs posted in the corner, resting against the turnbuckles with a cocky smirk.
âDavid, I donât like the sound of this champion. They say heâs undefeated. Just quit now and letâs get outta here.â I plead to David.
David laughs, âHaha, relax Dylan, I got this. Iâve heard this guyâs a bottom-heavy bruiser. Iâll run circles around him, tire him out, and have him pinned in the next 5 minutes. Iâm gonna be the next champion with you in my corner.â David boasts. Nice words but I still have a bad feeling.
Suddenly, music starts playing and the announcerâs voice fills the warehouse. âLadies and gentlemen, for tonightâs main event we have the debut of our newest wrestler, David Quick.â David holds up his arms, smirking at the crowd, but heâs mostly getting booed.
âAnd here comes your undefeated champion. The toxic tormentor, the skunky sadist. NASH CHAMBER!â
The crowd goes wild and my eyes widen, as a 6â3 behemoth swaggers towards the ring. Heâs wearing a gray, skin-tight wrestling singlet that shows off his Hulk-like muscles. Compared to him, David looks like a malnourished boy.
Chamber steps into the ring and holds up his arms as the crowd cheers wildly for him. As he does a small little circle, me and Davidâs jaws drop. From behind we see his enormous bubble butt. His singlet looks like itâs being stretched to their limit in containing Nashâs watermelon-sized butt cheeks.Â
David shakes his head, getting back into the game, and starts bouncing from foot-to-foot, warming up.Â
Once Chamber is done hyping up the crowd the two face off in the center of the ring. David holds up his fists looking determined. While Chamber stands with his hands on his hips, sporting a cocky grin.
The starting bell rings and David punches Chamber right in the chest. Chamber doesnât even flinch, just keeps smiling. The crowd laughs at Davidâs weak punch, and I see David turning red with anger.Â
âDavid, keep your cool!â I yell, but he isnât listening.Â
David dashes behind Chamber and cocks back his fist. Thatâs when I notice Chamber scrunching up his face.Â
Before David can punch Chamber in the back of the headâŚ
BBBBBBBBBBRRRRRRRRRRRFFFFFFFFFFTTTTTTTTTT
Holy shit, Chamber just ripped a 10 second, thunderous fart thatâs louder than the cheering crowd of hundreds. David is immediately stepping backwards, covering his nose with his hands and coughing.Â
I should hate seeing my boyfriend suffer but thatâs one of the hottest things Iâve ever seen. I have a secret farting kink and Iâve never seen someone fart like that. Chamber looks over at me and gives me a sly smirk and a wink.
The announcer then comments, âOh, Quick made the worst rookie mistake you can make. Never step in the blast zone of CHAMBERâS NOXIOUS BUTT-CANNON!â His shouts, making the crowd cheer even harder.
Chamber turns around and grabs David by the arm. He then throws him towards the ropes. David bounces off the ropes and is heading back to Chamber. Chamber turns around and jumps. David runs face-first into Chamberâs blubbery, aerial mounds. As soon as they make contactâŚ
FFFFFFFHHHHHHHHHPPPPDDDDDD
Chamber actually clotheslines David with his gassy ass, knocking him to the ground.
Davidâs on his back, groaning. Chamber looks down at David, over his shoulder, with a mischievous grin. He then starts smacking his ass with both hands, making his meaty melons wobble.
The crowd then start screaming, âGeronimo, Geronimo, Geronimoâ
âUh-oh, I hope the rookie brought his umbrella because it looks like itâs about to start raining fat, farting asses!â The announcer calls.
Chambers pulls his legs out from beneath himself, and lets his bulbous backside crash onto Davidâs face. I wince at the sound of the impact. David weakly tries to push Chamber off of his face, but all heâs really doing is sinking his fingertips into Chamberâs quicksand-like ass fat.Â
Chamber curls his hands into fists, grits his teeth, and starts straining. PPPFFFFTTTT
Chamber rips a short but loud, warehouse-echoing poot in Davidâs face.Â
Chamber lifts his titanic rump a foot above Davidâs face, revealing it. Davidâs red-faced with teary eyes, and having a coughing fit.Â
Not even a second later, Chamber slams his big butt back on Davidâs face and poots again. He keeps doing this again and again on Davidâs face.
Up, Slam⌠RRRHHHHPPPP
Up, Slam⌠FFFFFDDDDBBB
Up, Slam⌠PPPVVVRRRRR
Up, Slam⌠BBBBWWWWFFFÂ
Chamber does this for several minutes straight; demolishing my boyfriendâs face with his weaponized booty.
My boyfriend is getting destroyed by this farting monster and Iâm more turned on than worried for his safety. Man, Iâm an awful person.Â
Chamber finally stands up. With a cocky smirk, he reaches down, grabs David by the hair, and pulls him onto his knees. David looks miserable and defeated.
 Chamber keeps his grip on Davidâs hair as he points to the turnbuckle. The crowd starts chanting, âStinkface, Stinkface, Stinkface.â
Chamber drags David to the corner of the ring and lays him down so the back of Davidâs head is lying against the bottom turnbuckle.
Chamber then turns around, and then squats down, aligning his ass with Davidâs face. Holy shit, I remember watching pro-wrestling when I was younger, and seeing the superstar Rickishi doing this to his opponents.
âOh yes ladies and gentlemen, here comes Chamberâs tried and true Stinkface. Letâs hope Quick has a sweet tooth because his face is about to be in a whole lot of cake.â The announcer jokes.
And with that, Chamber thrusts his hips back, smothering Davidâs face with his mountainous mounds of ass fat.Â
Chamber immediately starts wiping his bubbly ass from left to right, and up and down, all over Davidâs face.
Chamberâs eyes find me again and he gives me a wink and this time accompanies it with an air kiss. Fuck, this guyâs humiliating my boyfriend, he shouldnât be turning me on.
Still wearing a cocky smirk, Chamber narrows his eyes in concentration before he starts lighting Davidâs face up with farts as he continues to Stinkface him.
PPPPPPFFFFFHHHHHHPPPPPP-FFFFFFFFWWWWWWWBBBBBBBDDDDDDD-RRRRRRRRRLLLLLLLLOOOOOOPPPPPPPP-BBBBBBBBRRRRRRRKKKKKKKKTTTTTTTTTTTT
Chamber unleashes a barrage of monstrous farts that can be heard over the crowdâs laughing and cheering.
After five minutes, Chamber finally gets off of Davidâs face. He throws both hands in the air, making the crowd cheer even harder for him. David looks half-dead, still resting against the bottom turnbuckle, barely moving.
Chamber pulls down the shoulder straps of his wrestling singlet, revealing his ripped upper body. He yells to the crowd, âHas he had enough?â before cupping a hand next to his ear, interacting with his fans.
âNOâ the crowd cries. Then they start chanting, âGas Him, Gas Him, Gas Him.âÂ
With a wicked grin, Chamber gives a shrug. âOh well, the people have spoken.â Chamber proceeds to pull his singlet completely off, now standing in the ring in only a gray jockstrap.Â
Iâm both hard and scared as Chamberâs meaty moons pour out of their confines and bounce freely in the open. In big black letters, Chamber has a word tattooed on each butt cheek.
âGASâ is tattooed on his left buttcheek and âCHAMBERâ is tattooed on the right one.
Chamber cups his hands beneath both cheeks and starts jiggling them, making the crowd go wild.Â
âUh-oh, it looks like the rookieâs headed straight for the Gas Chamber. Guess this is it for Quick. When the champ shoves someone into the Gas Chamber, they never come out alive.â The announcer explains.
Chamber walks back over to David and grabs him by the hair again. He drags David back to the center of the ring, on his knees.
David looks like a train wreck and is begging for mercy, but Chamber just ignores him. Chamber turns around, putting his bulbous, tattooed butt in Davidâs face.Â
With Chamberâs free hand, he reaches back and spreads open his globes before unceremoniously shoving Davidâs face into his toxic trench of an ass crack.
Davidâs face rapidly sinks into Chamberâs deep, voracious ass. Chamberâs pushy hand and swiveling hips work in tandem to bury David even deeper into the Gas Chamber.
Finally, Chamber lets go of his buttcheek. Chamberâs thick globes wrap around Davidâs head and make contact with each other. Iâm horny/horrified by Davidâs entire head being completely entombed in Chamberâs gargantuan rump, with the words âGasâ and âChamberâ side-by-side.
âQuickâs locked up in the Gas Chamber and the champ looks like heâs raring to go. The longest someoneâs survived in the Gas Chamber is three minutes. Letâs hope this lousy rookie can at least set a new record.â the announcer comments.
Chamber bends his knees slightly, and curls his hands into fists. He then closes his eyes and grits his teeth, and then starts grunting and straining.
BBBBBBRRRRRRFFFFFFFTTTTTTTT
PPPPPPPPPHHHHHHHHVVVVVVVBBBBBBBBBBB
DDDDDDDDMMMMMMMMMBBBBBBBRRRRRRRRR
FFFFFFFFFFFLLLLLLLLLLLDDDDDDDDMMMMMMMM
RRRRRRRRRRKKKKKKKKKOOOOOOOOBBBBBBBBB
Chamber is a machine. He keeps ripping monstrous farts that last from 10-15 seconds, pointblank in Davidâs face. Even with the cheering crowd and Davidâs face in front of his asshole, Chamberâs farts can still be heard all around the warehouse.
 David was already weak in the beginning but his flailing limbs are looking weaker by the second. I try for Chamberâs attention before itâs too late.
âWait, please stop!â I cry.
Chamber opens his eyes and looks at me. A cocky smirk forms on his face but his farting has paused for the moment.
âOh, looks like Quickâs boyfriend is trying to plead to Chamber to spare him.â The announcer observes.Â
Chamber flexes his glutes, trapping Davidâs head as he walks up to me, dragging a crawling David behind him.
âPlease let him go, heâs already lost.â I beg when Chamber is standing in front of me.
âSorry bud, but when I put someone in the Gas Chamber, theyâre done with their living. Why should I make an exception for this loser?â Chamber asks with a smarmy grin.
âPlease donât, I-Iâll give you anything.â
âHmm, anything you say? Well for me to even consider letting this loser live, Iâm gonna need an incentive. How about a kiss on the lips and then weâll talk?â Chamber suggests shocking me into silence.Â
To get the ball rolling again, Chamber closes one eye and grunts, ripping a squeaky fart in Davidâs face. âAh, you better hurry before your chump suffocates in the Gas Chamber.â
I surge forward and plant my lips on his, kissing him. Wolf-whistling and cat calls erupt from the crowd.Â
I pull my lips from his, blushing. I canât deny that, that was an amazing kiss.
âAlright then, hereâs the deal: to get him out youâre gonna have to take his place in the Gas Chamber.â Chamber says, making me choke on my spit.
âBut not now. Youâre gonna wait around, out here, after this match and everyone leaves. Iâm gonna come back out into this ring and youâre gonna willingly bury your face in my Gas Chamber. Agree to this and Iâll let your loser-of-a-boyfriend live.â
Iâm blindsided, not knowing what to say.
âDo we have a deal? Or am I sending this loser to the afterlife?â Chamber cocks his left leg and rips a greasy fart, further torturing my Gas Chambered boyfriend.
I audibly swallow, nervous about this arrangement. I nod my head and say, âYesâ.
âGreat, letâs get your boy-toy out of my Gas Chamber, shall we?â Chamber reaches back with both hands and spreads open his bubbly cheeks, revealing the back of Davidâs head. Chamber grits his teeth, scrunches up his face, and starts grunting and straining.Â
BBBBBBBBBBBRRRRRRRRRRRRRAAAAAAAAAMMMMMMMMMMPPPPPPPPPTTTTTTTTTTTTTT
A roaring, thunderous fart, that has the entire ring quaking, explodes out of Chamberâs ass. Davidâs launched out of the Gas Chamber, and lands on the ring floor, on his back, dry-heaving.
The crowd starts booing and the announcer voices his annoyance.Â
âWhat the hell is this? Why is our champion letting someone out of the Gas Chamber alive? It looks like Chamber is going soft.â The announcer complains.
Chamber narrows his eyes and glares murderously at the announcer whoâs standing just outside of the ring, with a microphone, looking towards the crowd. Chamber stomps toward him. I canât help but stare as the mounds of his Gas Chamber bounce and clap against each other with every step.
Chamber reaches through the ropes, grabs the screaming announcer by the hair, and pulls him into the ring. Chamber forces the announcer to his knees and takes the microphone away from him.
âSo yaâll wonât be happy unless I leave a corpse in the ring, huh? Then so be it.â Chamber addresses the crowd and then looks down at the announcer with a devilish grin. âAnd since you agree with them, Iâm sure these last few minutes of your life will put a smile on your face. Into the Gas Chamber with you.â
Chamber wheels around, putting his fat, tattooed globes right in the frightened announcerâs face. Chamber reaches back, spreading his cheeks with his free hand. He then carelessly pulls the screaming manâs face into the Gas Chamber.Â
I watch as another victimâs entire head is consumed by Chamberâs enormous ass. Â
The crowdâs cheering again and starts chanting, âGas Him, Gas Him, Gas Himâ
Chamber widens his stance, curls his hands into fists, and grits his teeth.
PPPPPPPPPPPPPPPLLLLLLLLLLLLLLLLLWWWWWWWWWWWWWWWRRRRRRRRRRRRROOOOOOOOOOOOOOHHHHHHHHHHHHHHHFFFFFFFFFFFFFFTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVVVVVVVLLLLLLLLLLLLLLLLLMMMMMMMMMMMMMMMMMMMMDDDDDDDDDDDDDDDDDDDDDDD
An ungodly fart roars out of Chamberâs ass and into the announcerâs face for 5 minutes straight. This behemoth-of-a-fart doesnât seem humanly possible. Me and others nearby have to cover our ears from how loud it is. And as I look around I see a slightly brown tint in the air.Â
2 minutes into the monstrous fart, and I see the announcerâs struggling body go limp, but that doesnât stop Chamber.Â
Once this massive leviathan-of-a-fart comes to an end, Chamber pulls the guy out of the Gas Chamber and lets his body fall to the ground.Â
Another announcer runs out from the back and slides into the ring. He takes the microphone and lifts Chamberâs hand into the air. âAnd here is your undefeated champion: NASH CHAMBER!â
And the crowd goes wild for him. Chamber swaggers up to me with a cocky grin. âDonât forget the deal.â He reminds me.
âI-I wonâtâ I reply. Chamber gives me another wink and heads backstage. People come out to help David and deal with the announcerâs body. As the rest of the crowd leaves, I wait just outside the ring.Â
Iâve been pacing for the last 15 minutes when David comes out from backstage. I smile as I try to give him a hug, but he steps back, out of reach.Â
âIâm sorry Dylan but weâre over. And Iâm leaving the city. Nash ordered me to do this or heâd put me back in the Gas Chamber. And this time no one would be able to save me.â With that David just leaves.Â
I feel empty as I watch him leave. This monster cost me my boyfriend and now heâs about to destroy me. The only silver lining is that heâs gonna fart in my face.
A few minutes later, the place is eerily deserted, and Chamber comes back out from backstage. Heâs still only wearing a gray jockstrap Â
As we both get into the ring, Chamber starts to speak. âYou know, wrestling as long as I have, you learn to read people both inside and outside the ring. The moment my eyes landed on you I knew what you were. Heh, when I first farted in my match, you were blushing like an untouched virgin.â
Itâs frightening how perceptive he is.Â
âI immediately knew that I had to make you mine. That loser Quick doesnât deserve you. No, you deserve to accompany a winner like me to the ring.â
My eyes widen; Chamber is still smirking.
âTell me you donât want me to fart on you, tell me you donât want to stick your face in the Gas Chamber. Tell me and you can go. I wonât stop you.â
I look down at his lips, unable to look him in the eyes. Unable to confess the truth.
A wolfish grin forms on his lips. Chamber walks up to me and then spins around and presses his bare ass against my lower midsection.Â
PPPPPPRRRRBBBBTTTTT
I feel his warm butt air venting against me. The stench of rotten eggs and broccoli reaches my nose. My breathing is becoming faster.
Chamber looks back at me, over his shoulder, with a knowing grin. âI know a fart-sniffer when I see one. Stop fighting it. Beg me to fart on you. Beg me to put you in the Gas Chamber.â
I canât do it.
Chamber suddenly grabs me and quickly but gently takes me to the ground. With experienced maneuvering, I find myself in a reverse head-scissor hold. My headâs trapped between his muscular thighs with his tattooed bubble butt right in my face.
He flexes âGasâ and âChamberâ, and once he relaxes themâŚ
BBBBBBRRRRRRRHHHHPPPPPPPP
He blasts me with a loud butt bomb that trumpets throughout the warehouse, my face being in its way be damned. His sulfuric, nose hair-singeing fumes are nauseatingly amazing.
After a few moments of no more farts, I glance up, over Chamberâs fleshy hillside-mounds, and see him peering back at me with a cheeky grin.
Why isnât he farting anymore? Then I remember his words.
I bring my hands up and start running them all over his rotund, fat-coated globes.I love the feel of his butt-blubber pouring through the gaps of my fingers.
With his ass fat nearly covering my mouth, I beg, âPlease fart in my face.âÂ
âAw such manners. Now thereâs a good fart-sniffer. Enjoy⌠NGHâ
FFFFFFFFFWWWWWWWWWRRRRRRRRAAAAPPPPPPP
A typhoon of hot, sulfuric ass wind flies up my nose and I love it. Chamber tightens his quads around my head, pulling me in and smothering my face against his pillowy yet firm buttcheeks.
Chamber starts swiveling his hips, rubbing his bare bum all over my face while unleashing a category 5 fart storm.
BBBBBBBBBRRRRRRRRRRWWWWWWWPPPPP
âYeah thatâs it. Kiss it!â
RRRRRRRRRMMMMMMMMMOOOOOOOOOBBBBBBB
 âTaste it!âÂ
PPPPPPPPPPLLLLLLLLLLL-HHHHHHHHHDDDDDDDD
âShow it the love it deserves!â
RRRRRRRRRRRAAAAAAAAAAKKKKKKKKKPPPPPPPP
âWorship my nasty, unbeatable booty!â
FFFFFFFFFFRRRRRRRRRROOOOOOOOPPPPPPPPP
DDDDDDDDDHHHHHHHHHHHAAAAAAAABBBBBBBB
FFFFFFFFFFFFWWWWWWWWWUUUUUUUMMMMMMMM
Spurred on by his words and huffing up all his noxious ass gas, I start peppering his meaty globes with kisses, and licking the sweat trickling from his ass crack.Â
This is too much, I feel like Iâm about to shoot. My bodyâs starting to shake.
âWhoa-whoa, letâs pump the brakes. We donât want the fun to end too soon.â Chamber says as he frees me from his head-scissor and rolls me onto my back, before lying his enormous self on top of me, making me groan.Â
âHere, maybe thisâll cool you down.â He continues with an arched eyebrow.
Chamber lifts up his arm and plants his sweaty armpit on my face. He then starts wiping his armpit from left to right, drenching my face in his musky sweat.
Even though Iâm loving this too, it does surprisingly start to cool me down. So caught up, I donât even realize that Iâm licking Chamberâs sweaty pit until he jumps off of me and growls. âYouâre fucking insatiable, I canât take it any more. Itâs time to put you in the Gas Chamber.â
Something sounding so foreboding shouldnât sound so hot.Â
Chamber stands up and faces away from me. I get onto my knees and come face-to-face with his thick cakes. The words âGASâ and âCHAMBERâ are right before my eyes.Â
Unable to resist, I bring my face towards his ass but he takes a step forward, putting distance between us. âBegâ He growls, huskily.
âPlease put me in the Gas Chamber. Iâve never wanted anything more.â I beg.
Chamber reaches back with both hands and spreads open his beefy slabs, revealing his asshole.Â
I follow his silent command, diving my face in between his imprisoning cheeks; pressing my nose and lips against his asshole.Â
Chamber lets go of his cheeks, entombing my entire head in his Gas Chamber.
âThere you go, nice and trapped in my Gas Chamber, with no way to escape⌠FGHâÂ
FFFFFFRRRRRRRRRRWWWWWWBBBBBBBB
I take a 9 second, eggy fart, right up the nose. So turned on by his raunchy ass fumes, I start licking his winking, sweaty pucker. Chamber moans above me.Â
âOh fuck yeah. Eat my nasty, butt-bombing hole you crazy fuckerâ RRHHBBRR âEat this too while youâre at itâ BBWWTTDD âYeah keep that throat open, Iâm dropping another air biscuit down your gulletâ FFMMOOHT âFuck yeah, youâre a perfect, willing fart-snifferâ RRFFVVBBB âGonna get you addicted to my stinky ass gasâ PPWWLLAB âMake sure youâre in my bed every nightâ FFHHTSTSSS âBegging me to lock your face in my Gas Chamberâ BBBBRRRRR-MMMMMOOOOO-DDDDTTTTTT
âDamn, youâve been locked up in the Gas Chamber for 7 minutes and youâre still frenching with my hole like some love-sick teenager. As soon as I trap someone in there, theyâre already trying to escape, but not you. Letâs see if this big fella heading your way will fix that. Oh well, itâs not like it really matters. No one escapes the Gas Chamber⌠NGHâ
BBBBBBBBBBBBBRRRRRRRRRRRRRRAAAAAAAAAAAAAAMMMMMMMMMMMMMMPPPPPPPPPPPPPPPOOOOOOOOOOOOOOOOOOVVVVVVVVVVVVVVVVVVHHHHHHHHHHHHHHHHDDDDDDDDDDDDDDDDDDDDDTTTTTTTTTTTTTssssssssssssssss
Chamber unleashes another one of his inhumanely loud and long farts, right in my face. I take in deep breaths, torturing my lungs with his digested meat and onion smelling fumes. Even for a fart lover like me, itâs too much and I pass out halfway through. Right after I shoot my load in my boxers.
I groan as I come to. My face repeatedly bumping against something soft yet firm, awakens me. I open my eyes and right in my face is Chamberâs fat ass in a pair of black, form-fitting compression shorts. Iâm slung over his shoulder and weâre walking through the deserted parking lot.
âWhatâs happening? Where are we going?â I ask, groggily.
âHeh, donât you remember? Youâre mine now. Weâre heading back to my place. Why donât you get some more sleep? When you wake up youâll be in my bed and your handsome mug will be heading back into my Gas Chamber. Deep huffs fart-sniffer.â
Chamber pauses in the middle of the parking lot and hikes up his left leg with my upside-down face in front of his bubble butt.
FFFFFFFFLLLLLLLLLLLHHHHHHHHHHHHHOOOOOOOOOOOPPPPPPPPPP
Smell of the x gene
In this story mutants and the X-men exist. Also the final part of this story gets rather explicit.
Itâs Valentineâs day but me and Austin, my boyfriend of 4 years, are just going to have a chill day this Saturday with the long week we endured. First we bought a house and weâve been spending most of the week moving. And then, just yesterday I found out that Austinâs been keeping a huge secret from me for four years. Heâs a mutant.Â
Yesterday morning I woke up and found two Austins in my bed. His mutant power is that he can make numerous duplicates of himself. At first I was livid but it quickly subsided when he told me that he was scared that Iâd hate him for being a mutant. I could understand that. There are a lot of groups who want the entire mutant population dead. I immediately quelled Austinâs fear by telling him that I still love him and I think his mutant power is awesome. I also told him Iâm a huge fan of the X-men and they do great work.
This morning, I wake up to the smell of eggs and bacon. I make my way into the kitchen and find Austin cooking. I shake my head in wonder as three sexy Austins are cooking. Oneâs frying eggs on a pan, oneâs defrosting bacon in the microwave, and the last is cutting up some fruit. All their backs are to me and theyâre only wearing a pair of black underwear. My eyes are zoned in on the Austinsâ fat, bubbly ass cheeks as they bounce and flex as they work. Austinâs handsome, tall, muscular, and has an insanely fat butt.
The three Austins turn around and notice me with smiles. They walk up to me together. The two flanking the middle Austin melt into him, leaving me with the original Austin. He gives me a kiss and then we set up breakfast at the dining-room table.
While eating Austin smiles and says, âRon, itâs Valentineâs day and I got something special planned for you.â
I frown, âAustin with the whole move, we promised no Valentineâs gifts.â
âYeah, but what Iâm going to give you doesnât cost any money. Now that you know about my mutant ability, I thought we could have a lot of fun with it, all today.â With a smirk, Austin cocks his leg andâŚ
PPPPPPGGGGHHHHTTTTT
Austin farts and I can feel my face turning red. One thing that really brought us together is our shared farting kink. To be more precise: I love getting farted on and Austin loves farting on me. And time and time again Austinâs proved that heâs that gassiest man alive. Heâs always farting, especially around me.
Austin stands up, rounds the table, and his voice becomes husky. âHappy Valentineâs day Ron. Me and my clones are going to be farting all over your body today. Not a single inch of your body will be safe from my butt stink.â Austin says as he takes my hands into his and stands me up.
âA-are your clones gassy as you are?â I ask with an obvious hard-on.
Austin cockily smirks without saying a word. Austinâs body then ripples and a duplicate of his slides out of him, and it steps around me. I then feel him back his thick rump against my lower back.
Austinâs clone then says, âDoes this answer your question.â and then farts on me. I gasp, feeling the warm, heated air venting against my lower back. The clone sighs in relief and starts rubbing his ass against me, grinding the stench in.
I moan as Austin Prime (what I like to call the original Austin) brushes his hand over my hard-on in my boxers. âOh yeah baby, Iâm trapping you in a vicious cycle. Me and my clones are going to be farting on you again and again and again, and Iâm gonna make you shoot your load again and again and again, until youâre shooting blanks.â
Prime Austin then looks at his clone, over my shoulder. âYou know, I think we need to convince him that you guys can fart like me. Heâs felt the power of your butt bomb against him but now he needs to smell it.â
âHeh, youâre right! Why donât you stick his face on in there. This next one has his faceâs name on it.âÂ
Prime Austin spins me around and then shoves me to my knees. I fall to my knees and am face-to-face with clone Austinâs bulbous backside. I then feel Prime Austin grab the back of my head and shoves me face-first into his cloneâs ass, smothering my face with his doughy ass-mounds.
As soon as my face is buried in his ass⌠FFFFRRRRRRTTTTTTTT MMMMMMLLLLLLLPPPPPP. Clone Austin rips two airy farts, back-to-back, in my face that reek of rotten eggs and garlic.Â
âOh yeah, I trust he wonât be doubting us clonesâ farting abilities after huffing up that bad boy.â Austinâs clone quips.
âTrue, but letâs give him a taste of the originalâs butt fumes so he can compare and be 100 percent certain.â Prime Austin adds.
With that the two switch and now clone Austinâs holding the back of my head and Prime Austinâs fat, bubble butt is right in my face. My face is once again shoved against a pair of underwear-clad, basketball-sized butt cheeks.
âHappy Valentineâs day my sweet. It isnât chocolate but Iâm sure youâre going to love gobbling this downâÂ
FFFFFFFFFFFFHHHHHHHHHHHHLLLLLLLLLLLLLPPPPPPPPPPPPPP
Prime Austin rips a long, trumpeting fart pointblank in my face. It smells just as bad as his cloneâs fart. It has me gagging and coughing and I love it.
âAh, that felt goodâ Prime Austin starts as he wiggles his ass all around my face. âBut let me show you something else. Something youâll be experiencing daily, when weâre alone.â
Clone Austin releases the back of my head but before I can even think of pulling my face out of Prime Austinâs ass, something big and both firm and fleshy presses against the back of my head, keeping my face trapped against Prime Austinâs ass. I instantly realize itâs clone Austinâs ass pressing against the back of my head, especially as I feel his doughy cheeks pour around the sides and make contact with Prime Austinâs cheeks, completely entombing my head in all of this Austin ass fat.
âWelcome Ron to your first of many stays in my Cake Prison. Donât let the name fool you, thisâll be anything but sweet⌠NGHâ
PPPPPPPPPWWWWWWWWTTTTTTTT-RRRRRRRRRLLLLLLLLLMMMMM-FFFFFFFFFVVVVVVVHHHHHHH-PPPPPPPUUUUUUUUUKKKKKKKKKK-BBBBBBBBBBBBBDDDDDDDDDDDDFFFFFFFFF-VVVVVVVVVVWWWWWWWWWDDDDDDDDDDDD
The back and front of my head are on the receiving ends of Austinâs farts. Itâs like their big asses are having a heated conversation and my headâs stuck in the middle. Iâm trapped in a sulfuric vortex of their combined farts and itâs overwhelming. Without touching myself, I cum before passing out from this intense experience.
LATER
PPPFFFTT. Iâm jolted awake with a poot to the face and find Austinâs meaty rump, confined in his form-fitting underwear, right in my face. Austin straightens up and turns around, and I notice that Iâm sitting on the couch.Â
My eyes widen as I take in the five Austinâs, including Prime Austin, standing in front of me. Theyâre all smirking down at me.Â
The middle one, who I assume is Prime Austin, speaks. âSorry to wake you up babe but youâve been asleep for an hour and I have a game I want to play with you. And if you win this game weâll have some more gassy fun. But if you loseâ One of his clones hands him a teddy bear, âIf you lose then you have to sit back and watch as this bear gets to enjoy our gassy techniques.â With a lopsided grin, Prime Austin holds the bear against his ass and scrunches up his face in an exaggerated manner.
PPPHHHHFFFFF-PPPPWWWPPP
He hands the bear off to his clones and the four each take turns farting on it.
I lick my dry lips and ask, âOkay so whatâs this game?â
âI call it âWhat did Austin eat?â. While you were unconscious the five of us ate five different things. Each of us is going to fart in your face and you have to guess what that Austin ate. If you guess at least 3 out of 5 correctly, you win. Any less and you lose. Are you ready to play?â Prime Austin asks with a cheeky grin.
I nod my head, determined to win. âIâm ready.â
The Austin on the far left walks up to me, spins around, and bends over, extending his beefy ass into my face.
BBBBBHHHHHHHHDDDDD
An airy fart that stinks of digested meat and cheese blows over my face.
âA slice of leftover pizzaâ I call out immediately.
âYou got it,â the clone congratulates. Suddenly he reaches back and grabs the top of my head. Then he pulls my face into his ass and⌠PPPFFTTT.
He sighs in relief before walking away and then another cloneâs bubble butt is in my face.
Ffffffffftststsstsss
A small wet fart, that only stinks of Austinâs ass musk, hits my nose, baffling me.
âUh, baconâ I guess.
âOh sorry love, that was a pop tart.â The clone straightens up and presents to me his side profile as he takes the teddy bear from Prime Austin. He looks at me as he presses the bear against his ass, cocks his leg, and closes one eye. RRRRLLLLLLLLDDDDD
Never thought Iâd be jealous of an inanimate object.
The third clone backs his fat rear into my face.
BBBBBB-FFFFF-PPPPPP
This one sounds like a machine gun and smells of rotten eggs.
âOh, uh the eggs from earlier.â I answer.
âWeâve got a winnerâ This one reaches back, takes my hands into his and pulls me forward. Iâm jolted forward and my nose is planted in between his butt cheeks. TTTTTTTHHHHHHBBBBB
The fourth one steps up and points his pillowy rump in my face.
PPPPPPLLLLLLLWWWWWWDDDDD
He rips a trumpeting fart in my face that kinda smells like rotten fish.
âUm, cod?â I take a shot in the dark.
âOh, sorry love, what youâre smelling is the protein bar I had.â The clone spins around, bends at the knees, and sticks his ass out, in the opposite direction of me. Prime Austin, whoâs holding the bear, presses it against the cloneâs ass. The clone grunts and⌠FFFGGGGGPPPPPPP
Itâs finally Prime Austinâs turn. He turns around and backs his meaty butt up until my nose is within 2 inches of his crack.
âSweety, youâve got to answer what I had correctly if you want to win. Here let me help you out. Why donât I make sure thereâs nothing in the way of my glorious butt fumes to your nose.âÂ
Prime Austin pulls down the back of his underwear and his plump, fuzzy ass-mounds spill out into the open and bounce in front of my eyes. He then spreads his cheeks revealing his fur-surrounded pucker. I watch his hole open up, then a stream of ass wind silently flows out and into my face.
I instantly start gagging on the sbd that stinks of rancid beef and raw sewage.
âOh, unfair Austin! You gotta warn me before you eat supreme tacos from Taco Bell and fart in my face! You know that!â I gripe at him.
Austinâs ample globes jiggle from his laughter. âHehe, sorry about that babe, but hey, you got it right. Youâve won Ron and now hereâs your prize.â he says as he pulls his underwear back up.
Suddenly Iâm pulled off the couch and put on my knees. All five Austin surround me and then spin around. My head is now surrounded by an impenetrable ring of their fat bums that are cheek-to-cheek. Thereâs only a few inches from me and any of the asses.
âWelcome to my fartagon Ron, my smelly interpretation of a pentagon. My familyâs full of mutants so they know about my power. Because of that, my little brother and cousins have a lot of experience with my fartagon. And now youâll become a regular in here as well.â
All the Austins lean forward and put their hands on their knees, pushing their fat asses out. My head is instantly pressed against from all sides, trapping me.
âAlright gentlemen, this is for my handsome Valentine. Let âem fly⌠NGHâ
PPPPHHHBBBBBBTTTTTTTT, FFFFFFWWWWWWPGGG, BBBBBBBBHHHHHHHWWWRRRRRR, PPPPPPPPRLLLLLDDDDDDD, FFFFVVVVVVUUUUUBBB, BBBBBBBBHHHHHHTTTTTFFFFFF, PPPPPPUUUUUUUDDDDDDBBB, RRRRRWWWWWWLLLTTTTT, GGGGPPPPPBBBTTTTT, FFFFFFVVVVVV-TSTSTSTSTSSS
My head is met with a variety of different-sounding farts coming from all directions. Itâs like Iâm trapped in a putrid hurricane made of every type of stench Austinâs ass is capable of. Every inch of my head keeps receiving one fart after another.
Itâs too much and Iâm once again, cumming hands-free. I blissfully pass-out in Austinâs fartagon.Â
LATER
I come to, feeling myself being lifted up, bridal style, in muscular arms. I open my eyes and Austinâs looking down at me with a lopsided grin. Weâre still in the living-room.
Iâm about to ask âhow long was I out?â but Iâm stopped by the sound of multiple Austin farts being ripped simultaneously. And none came from Prime Austin whoâs holding me.
I look around and see one or two Austin clones in every visible room, farting on any and everything.
In the living-room with us, an Austin clone is picking-up our framed pictures on the end tables and farting on them.
In the dining-room, a clone is sitting in every chair and ripping a fart. And another clone is sliding across the top of the dining-room table, on his knees, farting as he slides along.Â
In the kitchen I spot an Austin clone opening the microwave and farting in it. Next, he opens the silverware drawer and farts in it. And then he opens the fridge, turns around, and sticks his butt into it, to my shock and horror. The clone catches me watching and gives me a smirk and a wink. Then he scrunches up his face and rips a tuba-sounding fart that ends on a wet note, butt bombing our food.
Prime Austin snickers and starts carrying me somewhere. âCome on my cute Ronnie. I have something planned for you in the bedroom that youâre gonna love. And ignore all this, me and my clones are just making sure that our new home smells like your favorite place. My ass! Hahaâ
As Austin carries me to the master bedroom, I watch as his horde of clones swarm throughout the house, farting on everything.
We pass the bathroom and an Austin clone is standing in the middle of the room, leg cocked, and ripping a juicy fart.
âWhat the hell are you doing?â Prime Austin calls out, annoyed. âTurn on the shower and fill the room with steam. Thatâll help our farts stink up this room much worse.â
The clone slaps his own forehead. âOf course, what was I thinking?â he admonishes himself.
Prime Austin walks up to him and says, âAre you trying to ruin my Ronnieâs smelly Valentines? Here, I think you should make it up to him, show him youâre sorry.â Prime Austinâs wearing an impish grin as he mock chastises him.
When Prime Austinâs in front of the clone he squats, with me in his arms, lowering my face to the level of the cloneâs waist. With a sly grin the clone says, âSorry Ron, please take a whiff of my forgiveness.â he then spins around, backs up, and plants his meaty rump on my face.
PPPHHHHHRRR. He rips an eggy fart in my face that has me gagging. Both Austinâs are laughing as Prime Austin carries me out of the bathroom. Just as we leave I hear the shower being turned on and then⌠RRRRLLLLBBBBTTTT.
We enter our bedroom and find a single clone in here, standing next to the bed. He has my pillow pressed against his ass and is ripping a series of squeaky short poots.
When the clone notices us, he smiles and lets my pillow fall to the floor. He then pulls down his underwear, and Austinâs hard and thick 7.5 inches springs out.Â
Austinâs clone flings himself onto the middle of the bed, on his stomach, facing the headboard, in a spread eagle position. I nearly swoon from clone Austinâs fat, bare globes jiggling and clapping against each other as he lands on the bed.
Prime Austin then stands me at the foot of the bed, having me face his naked clone. Prime Austin then covers my back with his chest and I feel his raging hard-on against the cleft of my ass.Â
Prime Austin yanks down my boxers and gives my bare ass a smack, making me yelp. He then growls in my ear. âI hope youâre still prepped from last night because itâs time for aâŚâ Prime Austin accompanies every one of his next words with a forceful hump. âHard⌠Smelly⌠Valentineâs Day Fuck!â
Prime Austin suddenly grabs the back of my head and shoves my face down onto the bed. My face is headed straight for his cloneâs bulbous backside, and thatâs where it lands. I find my face wedged deep in between clone Austinâs pillowy mounds.Â
Iâm now bent over the bed with the upper half of my body draped on the bed and my feet still on the floor.
I canât see a thing but I hear Prime Austin pulling down his underwear, then the cap of a bottle popping open, then the wet sound of Prime Austin lathering himself.
We both moan as Austin slowly but surely drives his over 7 inches of meat into me.Â
Weâre both panting once heâs fully sheathed inside of me. Prime Austin grabs my hand, pulls it back, and presses my palm against his fuzzy abdomen. I feel a lot of aggressive bubbling and churning going on in his stomach.Â
âMmm, you feel that love? My rear thrusters are raring to go.â Prime Austin coos.Â
Rear thrusters is what Austin calls it when he farts as he fucks me. He brags that his farts give him more power as he thrusts inside me.
Austin slides his dick halfway out and as he thrusts back in⌠BBBHHHRRRRPPPP.Â
Pull out⌠Thrust⌠FFFFFFFLLLLLPPPPPP
Pull out⌠Thrust⌠BBBBBBBDDDDDDDPPPPPP
Pull out⌠Thrust⌠RRRRRRRPPPPPPPPPMMMMMM
While still fucking me, Prime Austin reaches forward and smacks his cloneâs bubble butt, making his blubbery globes ripple around my consumed face. Because of that action, my face sinks down further and I feel my lips kissing his pucker.
âYouâre up, gift my Valentine something good.â Prime Austin orders.
Austinâs clone then calls out, âSay ah Ronnie, here comes some digested-chocolate farts. Some sweets for my sweet⌠FGHâ RRRRRHHHHHLLLLLRRRRR
BBBBPPPPFFFFF, MMMMMMLLLLLDDDD, HHHHFFFFFPPPPP, BBBBVVVVVVVMMMM, FFFFFFFKKKKKKWWWWW, RRRRRRRUUUUUUUFFFFFFF
Both Austins are non-stop farting machines. Clone Austin keeps blasting my face with his spoiled milk smelling farts and Prime Austin keeps farting as he fucks me, filling the room with his butt fumes.
Prime Austin picks up speed, and it feels like weâre both about to shoot. Just as Iâm about to, Austin stops. Suddenly Prime Austinâs pulling my face out of his cloneâs ass and flipping me onto my back. The back of my head is now using the cloneâs plump ass as a pillow and Prime Austin has my legs tossed onto his shoulders.Â
I blink rapidly, my eyes getting re-used to the light. I gawk at what Iâm now seeing. Prime Austin is sweaty but looking down at me with a smirk. 6 clones of Austin, also naked, surround the bed, all smirking as well.Â
One of the clones climbs into the bed, and over me. He turns around, straddles my shoulders, with his ample ass-mounds hovering a foot above my face. Through his legs, I see Prime Austin with the same impish smirk.
âJust think Ronnie, two days ago you could barely deal with my single big ole booty. But from now on, Iâm gonna be overwhelming you with several of them at once. Happy Valentineâs day baby.â
With that the Austin clone takes a seat on my face, smothering me and Cake Prisoning my head in between, well two thick Austin cakes.
Once again Iâm sealed in complete darkness.
I grunt as another clone climbs onto me, and sits on my stomach. Then two more climb in and take seats on the middle of each arm, pinning them to the bed. The last two stand by either side of the bed. I feel them take my hands and wedge them into their butt cracks.
Prime Austin starts pounding me again, and farting with every invading thrust. âSo fucking goodâ I hear him moan, mostly to himself.
âAlright my Austins, letâs make my sexy Valentine a happy boy. Donât stop farting until he and the entire house reeks of my butt bombs⌠HGHâ
FART * FART * FART * FART * FART * FART
âAh, you know what? Scratch that. Donât stop farting until him and the entire block reeks of my butt bombs⌠NGHâ
FART * FART * FART * FART *FART * FART
âOh, fuck it! Happy Valentineâs day Ronnie. Just for you Iâm gonna make fresh air go extinct. From now on, all the air we breathe on this planet will stink of my farts. Let âem blow gentlemen, show my love no mercy⌠UGHâ
BBBBHHHHHHLLLLLLLLLMMMMMMMMMM
FFFFFFFFFVVVVVVVVVVBBBBBBBRRRRRRR
PPPPPPPPWWWWWWWWWWWGGGGGDDDDDDD
DDDDDDDDDBBBBBBBBBBBRRRRRRTTTTTTTTTT
PPPPPPPPPPRRRRRRRRRROOOOOOOHHHHHHHHH
BBBBBBBBBBHHHHHHHHHHHHRRRRRRRRRRRRAAAAAAAAAAMMMMMMMMMMVVVVVVVVVVVVVPPPPPPPPPPOOOOOOOOOOBBBBBBBBBBBBBB

Anya is live and ready to show you everything. Watch her strip, dance, and perform exclusive shows just for you. Interact in real-time and make your fantasies come true.
Free to watch ⢠No registration required ⢠HD streaming
Smell of his bad side
For our high-school senior trip weâre staying at this world-class, ocean-side resort for the weekend. Unfortunately, when we arrive, I find myself rooming with two other guys I donât know all that well, instead of my friends. The first guyâs Cullen. Heâs a soccer player, the nicest person you could ever meet, and I have a secret crush on him . Thanks to being an athlete, heâs muscular but he also has an insanely fat ass. Today heâs wearing a blue polo shirt, and a pair of gray shorts that accentuate his melon-sized butt cheeks. Iâm definitely not mad about rooming with him.Â
My other roommate is a different story. Todd is a lithe guy whoâs a brat thanks to having rich parents. The three of us are now in our room and Todd is throwing a fit.
âHow dare they pair me with you two; I should have my own room! Donât they know who my father is?â he seethes.
The room is big with two beds and a couch. âLook man, Iâll take the couch, you can have a bed, and Cullen can take the other.â I try to placate him.
Todd sneers at me. âThatâs not the point you idiot. The point is that I should have my own room; I shouldnât have to be rooming with you two peasants.â
I frown at that. Peasants? Who still uses the word peasant?
âCalm down man, heâs just trying to helpâ Cullen defends me.
Todd turns his ire towards Cullen. âOh shut up and stay out of this you fat-assed neanderthal.â
Toddâs tantrum is pushed to the back of my mind as I see something Iâve never seen before. Good-guy Cullen looks pissed. His eyes, full of hatred, are locked on Todd.
Cullen gets right up in Toddâs face. âCall me that again and see what happens.â Cullen threatens.
With no sense of self-preservation, Todd smirks and says, âWe both know youâre not going to touch me, you fat-assed neanderthal.â
Both of Cullenâs hands shoot up and wrap around Toddâs slender neck. Toddâs eyes bug out and Cullen starts backing him towards the bed. When the back of Toddâs legs touches the bed, Cullen shoves Todd to his knees. Cullen then positions Toddâs head so itâs lying on the edge of the bed, face up. Toddâs too stunned to resist, which works out for Cullen.
Cullen turns around and Todd finds his face completely eclipsed by Cullenâs enormous ass. âI feel sorry for you rich boy. Youâre about to experience how fat-assed I really am.â With that, Cullen sits down hard, slamming his huge ass onto Toddâs face. Cullenâs bubbly butt shields every inch of Toddâs head from being visible. I look on in shock but canât deny that Iâm starting to get turned on.
Cullen closes one eye and grunts.
PPPPPPFFFFFFFHHHHHHTTTTTT
My jaw drops as Cullen rips a 5 second fart right in Toddâs trapped face. Only then does Todd start struggling. He starts to muffly scream and thrash around. Cullen smiles as he easily keeps Toddâs face under his ass.
âHaha thatâs it, struggle all you like, you ainât goin nowhere. Imma break you like a bronco, rich boy.â With that, Cullen starts bouncing his titanic rump on Toddâs face and farting.
Bounce âGet a whiff of this shitâ
BBBBBBBBMMMMMMMMPPPPPPTTTTTT
Bounce âAh, this is the reason my friends call my big, talented booty the Cullen Canonâ
RRRRRRRRAAAAAAAAFFFFFFFFPPPPPPP
Bounce âGet used to this Todd, my farts will be your only form of entertainment this weekendâ
BBBBBBBBPPPPPPPPPHHHHHHHHHHFFFFFFFF
Bounce âHey Todd, whereâs your fatherâs checkbook to save you now buddy?â
PPPPPPPPPLLLLLLLLLLRRRRRRBBBBBBBBB
Bounce âWith this next fart I christen you as my new fart-slave⌠GHH â
FFFFFFFFFFFWWWWWWWW-UUUUUUUPPPPPPPP-HHHHHHRRRRRRRR
Cullenâs bouncing and farting is rapidly depleting Toddâs strength. Toddâs struggling becomes weaker and weaker by the second, especially after Cullenâs last butt bomb which was three consecutive farts in a row that lasts 20 seconds.
As Cullen remains seated on Toddâs face, he glances to the corner of the room and his eyes light up when he sees his backpack.Â
âOh man, I forgot that I brought rope so me and the guys could use it to haze one of our teammates, but I think itâll be more useful for my fart-slave.â After hearing this, Toddâs struggling begins anew.
This amuses Cullen, âHaha, it seems like I still have to break this bronco. Maybe an sbd will do the trickâ With that Cullen leans to the left, lifting his right butt cheek off of Toddâs face. Half of Toddâs face is visible and his frantic eye finds me.Â
âPlease Joe get this freak off of me, I-Iâll pay you anything. I-â Toddâs cut off as he starts dry-heaving, letting me know that he just got a nose-full of Cullenâs sbd. Cullen fully sits back down on Toddâs face, silencing him.Â
âThatâs enough, out of you. A good fart-slave is a silent one.â Cullen says.
I start to walk up closer to them, Cullen narrows his eyes at me, ready to take me down if I try to help Todd. Instead, I walk past them, grab Cullenâs backpack, and I hand it over to him. Cullen smirks, âThanks manâ.Â
Cullen scrunches up his face and starts grunting and straining as he bears his thick ass down harder on Toddâs face. âTime for you to take a quick nap fart-slave. FGH⌠And donât worry about the smell, youâll never get used to it, hehe⌠NGHâ Â
FFFFFFFFFFWWWWWWWWWBBBBBBBBBBBBBOOOOOOOOOOTTTTTTTTTTT
I go slack-jawed, amazed as Cullen rips a 35 second, behemoth of a fart right on Toddâs face. I surprise myself as I feel a little jealous of Todd. That is until Cullen rises off of his face and the vile stench of digested meat and sulfur escapes and spreads throughout the room. My eyes start to sting from the smell but I see that Todd isnât moving.
âIs he still alive?â I ask nervously.
Cullen chuckles as he pulls several lengths of rope out of his backpack. âHeâs still alive. I just knocked him out for a little bit.â Cullen says as he ties Toddâs ankles together and then ties his wrists together, behind his back.
âCullen, what are we going to do? Weâre going to have to eventually free him, and when we do heâs going to snitch on us.â I confess my worries.
Cullen looks at me questioningly. âHe ainât gonna talk or do anything I donât want him to do. I already told you, Iâm making him my fart-slave.â Cullen says.
I roll my eyes thinking Cullen is just bullshitting me. Oh how wrong I was back then.
Cullen catches on that Iâm starting to freak-out. Cullen approaches me and suddenly shoves me onto the other bed. Next thing I know, heâs straddling my chest and looking down at me with a lopsided grin.
âYou know, youâre not as subtle as you think. Iâm constantly catching you staring at my butt when you think Iâm not looking. And I see that youâre hard after watching me butt bomb the hell out of Toddâs face. You know what I think Joey? I think you want to get up close and personal with my Cullen Canon.â
I canât believe Iâve been so obvious. Cullenâs grin grows at my look of alarm.
Cullen then turns around and says. âFor helping me out with Todd, youâve earned yourself a reward.â
I gasp as Cullenâs basketball-sized globes, trapped in a pair of ill-fitting shorts, hovers a few inches just above my face.Â
Cullen then says, âYou know the only thing I like better than butt bombing a dickâs face, like Todd, is lighting up a cutieâs face, like yours, with my fartsâÂ
Thatâs all the warning I get before he drops his big ass onto my face. I feel his warm, doughy cheeks molding around my face, smothering me. And I feel his butt crack right on top of my nose. I then hear Cullen straining above me.
âNGH⌠Youâve just entered a warzone Joey. The Cullen Canon is armed and youâre in its blast zone⌠UGHâ
BBBBBBBBBWWWWWWWFFFFFFFFRRRRRRRR
âAh, thatâs what my booty that youâve been staring at for so long is capable of. Do you want some more? What am I saying, of course you do⌠HGHâ
FFFFFFFLLLLLLLLLHHHHHHHHHPPPPPPP
RRRRRRRRRMMMMMMM-UUUUUUTTTTTTTT
âWhoa, youâre still hard as fuck. You must be loving the Cullen Canon. Well letâs see if I can make you regret that⌠GGHâ
PPPPPPPPPPPPHHHHHHHHHRRRRRRBBBBBB
âYou better be careful Joey. You wonât be my fart-slave but Iâll make you mine if you keep being this fun for me. You should think about that as I rip this monster⌠FNGHâ
BBBBBBBBBRRRRRRRRRAAAAAAAAAMMMMMMMMMMPPPPPPPPFFFFFFFFF
Cullen rips a barrage of farts, pointblank in my face. His last one is a behemoth of a fart that lasts 45 seconds. My eyes are watering and Iâm gagging against his bubbly ass. All I can smell is rancid fish and onions.Â
Cullen rises off of my face and glances down at me, laughing at my wrecked appearance. I gasp for semi-fresh air once Iâm free.Â
âIâd love to drown you in more of my butt stink Joey but Iâve got a fart-slave to break in. And it looks like heâs waking up.â Cullen says as he hops off the bed and walks towards Todd, whoâs indeed starting to awaken. Cullen stands on the bed, with his feet planted on either side of Toddâs shoulders, facing his feet, with his bulbous rump eclipsing all light above Toddâs face.
Toddâs eyes flutter open and he looks up in horror at Cullen standing over him with his fat bum lording above his face.Â
âOh no, this-this canât be realâ Todd cries.Â
Cullen looks down at Todd, over his shoulder, and laughs, causing his ample cheeks to jiggle. âHaha, that was no dream Stinking Beauty. This tripâs just started and you and the Cullen Canon are going to become real acquainted before itâs over.â With that, Cullen drops his ass onto Toddâs face like a meteor. I wince some when I hear Toddâs pain-filled groan.
Cullen wiggles his meaty backside from left to right on Toddâs face, getting comfortable. Cullen then takes a deep breath and grunts.
BBBBBBBBBMMMMMMMUUUUUUUUUURRRRRRRRR
Cullen sighs in relief after ripping a 7 second, butt bomb on Toddâs face. âAh, breathe in my precious butt stink fart-slave.â Cullen taunts. Toddâs bound-up body weakly twitches beneath Cullen.Â
Cullen then winces in pain as he starts rubbing his stomach. Cullen looks over at me and says, âI think you better make yourself scarce Joey. Iâm about to rip some serious ass and it ainât gonna be too pleasant.âÂ
âUm, maybe I can stay a bit longer. Youâll probably be out of gas after this.â
Cullen smirks at my hesitance. âGo on Joey and you donât have to worry about that. Havenât you already realized it yet? The Cullen Canonâs never emptyâÂ
I reluctantly oblige his order and leave to go hangout with some friends. Just as I close the door and am safe, from the other side of the door I hearâŚ
FFFFFFFFFRRRRRRRRRHHHHHHHHHHLLLLLLLLLLAAAAAAAAAPPPPPPPPPP
Cullen unleashes a monstrous fart that lasts a whole minute. That monster has so much power that I feel the doorknob rattling beneath my hand. Iâm pretty sure everyone on this floor heard that.Â
I head towards the elevator, successfully willing down my hard-on. I meet up with my friends in the lobby and we head on out. I have fun with my friends but I canât get the thought of Cullen torturing Todd with his farts, out of my head. So after an hour, I tell my friends Iâll see them later and head on back. On the way, I pick up two burritos from Chipotle for Cullen and Todd, since they probably havenât eaten yet.Â
As I open the door to our roomâŚ
FFFFFFFFFFVVVVVVVVVVOOOOOOOOOPPPPPPPPPPP
I step into the room and find Cullen watching tv while still sitting on Toddâs face, smothering him underneath his plump ass. Cullenâs shirt is off now, revealing his chiseled abs and pecs. The roomâs thick with Cullenâs eggy butt musk..  Â
âHey man, didnât expect you back so soon.â Cullen says. Nonchalantly, he hikes his right leg up slightly andâŚÂ
PPPPPPPPPPPWWWWWWWWWUUUUUUUURRRRRRRRR
âOh um, I felt tired so I decided to come back here and relax. I-Iâll hang out with my friends after the trip.â I stutter out. Obviously unconvincingly going by Cullenâs smirk.
âOh Iâm sure thatâs the only reason why you came back.â Cullen quips sarcastically before leaning to the side and closing one eye.
BBBBBBBFFFFFFFFFFFAAAAAAAATTTTTTTTT
Cullen rips a 6 second, bubbly fart right in Toddâs trapped face. Todd gives a muffled groan and slightly twitches but thatâs it. Damn, this is the hottest thing Iâve ever experienced; I canât stop myself from becoming hard. From Cullenâs growing smirk he notices it too.
I present my carryout bag to Cullen. âOh I got you two Chipotle. I figured you guys were hungry.â
Cullenâs eyes light up. âJoey youâre a fuckinâ godsend. Iâm fuckin starvingâ Cullenâs smirk then turns impish, âChipotle huh? Did you know that this stuff makes my farts smell 100 times worse. Oh you two are asking for it tonight.â Once hearing that, Todd struggles harder beneath Cullen, making Cullen snicker.
âWell get on over here Joey and bring me my food. And while I eat weâll chat and get to know each other. Weâve shared so many classes and hardly ever talked.â I hand the bag over to Cullen and take a seat on the edge of the other bed, facing him.Â
Cullen unwraps his burrito and starts eating and talking to me. Doesnât even seem to matter to him that heâs still sitting on a guyâs face and lighting him up with farts.Â
âSo where do you liveâ FART âNo shit, I donât live too far from thereâ FART âSo any siblingsâ FART âCool, Iâm an only childâ FART âHmm? Oh yeah Iâm always a gassy fuckâ FART âYouâre talking to the Fart King babyâ FART âWhen it comes to farts no one has out-gassed me yet and no one ever willâ FART âSo what are your plans after highschool? College?â FART âNo shit? Iâm attending the same schoolâ FART âHey maybe we can be roommatesâ FART
Before I can reply, Cullen holds up a finger, stopping me. âJust a second Joey, my fart-slaveâs trying to tell me somethingâ Cullen lifts his titanic rump up, revealing a panting Todd.
âI-I just wanted to apologize for how I treated you two and surprisingly Iâm going to the same college as you guys. Maybe we can start over and be friends.â Todd raggedly explains.
Cullen unceremoniously drops his fat cakes back onto Toddâs face, smothering him. âNope. Once a fart-slave always a fart-slave. Iâll never see you as a person again and soon enough, neither will you⌠GGHâÂ
PPPPPPLLLLLLFFFFFFFTTTTTT
Cullen leans forward, revealing Toddâs face again, whoâs in a coughing fit. Then Cullen pulls down the back of his shorts, exposing his hairy butt crack; making me nearly bust.
With Cullenâs fat, bare ass only a foot from his face, Todd looks freaked out. Cullen unwraps the second burrito and rips a piece off. He then brings that piece, behind his back, and in front of his bum. Cullen grunts andâŚ
BBBBBBBFFFFFFFAAAAAAPPPPPP
Cullen rips a 5 second fart, coating the piece of food in his butt stink. Cullen sighs in relief before bringing the tainted food to Toddâs lips.
Cullen looks down at Todd, over his shoulder, with a cruel smirk. âOpen up fart-slave, itâs supper time.â
Todd keeps his lips sealed and turns his head, but Cullen still wears that nasty smirk. âNow, now fart-slave, we can do this the easy way or the hard way. Either you can eat your food like a good fart-slave, or I can pry open your mouth and force the food down your throat with my farts. Personally Iâd choose option A. Youâll have to swallow fewer of my burrito-powered butt bombs with that option.â
With tears in his eyes, Todd reluctantly opens his mouth. Cullen pops the fetid piece of burrito into Toddâs mouth. Todd retches and gags as he chews, but he eventually swallows Cullenâs butt-poisoned food.
âThereâs a good fart-slave. Now say ah, thereâs plenty more where that came from.â
FFFFFFFFWWWWWWWWWWWHHHHHHHPPPPPPP
BBBBBBRRRRRRRRRRAAAAAAAAAAAFFFFFFFFFF
PPPPPPPPPHHHHHHHHHHUUUUUUUUUBBBBBBBBB
RRRRRRRRRRLLLLLLLLLLLLMMMMMMMMPPPPPPPP
BBBBBBBBBBBTTTTTTTTTTTFFFFFFFFFFFRRRRRRRR
FFFFFFFFFFFFMMMMMMMMWWWWWWWWTTTTTTTTTT
PPPPPPPPPPPPPFFFFFFFFFFFFFFOOOOOOOOOBBBBBBBB
FFFFFFFFFFFFFBBBBBBBBBBBBAAAAAAAARRRRRRRRR
RRRRRRRRRRRRUUUUUUUUUUWWWWWWWWPPPPPPPPP
BBBBBBBBBBBHHHHHHHHHHH-PPPPPPPPPPPPRRRRRRRRR
Nearly a dozen farted-on pieces of burrito later, Toddâs finished with his meal. He looks like he is in complete agony. Unfortunately, Cullen isnât done.Â
Cullen reaches back with both hands and spreads his ample cheeks, exposing his fume-sputtering pucker to a horrified Todd.
Cullen carelessly falls back, lodging Toddâs face in between his meaty globes. Cullen narrows his eyes in concentration as he starts grunting and straining. âJust in case youâre still hungry fart-slave Iâm about to feed you my personally made beefstew. Piping-hot, straight out the oven. NGH⌠bon appetit⌠UGHâ
FFFFFFFFFFFFRRRRRRRRRRRWWWWWWWWWWOOOOOOOOOPPPPPPPPPP
Cullen decimates Toddâs face with a 2 minute long, monster of a fart. Cullen fart is so monstrous that it has his whole bed shaking through the entirety of it. It also seems to take out Todd. Toddâs struggling becomes weaker and weaker after every second of Cullenâs fart until he seems lifeless half-way-through.
Cullenâs eyes are closed and he sighs in relief as his mammoth of a fart comes to an end. âAhh, damn that felt good.âÂ
Cullen lifts up, freeing Toddâs face, accompanied by a wet schlorp. Toddâs face is drenched with Cullenâs ass sweat, and a few of Cullenâs wiry butt hairs litter his face.Â
Cullen isnât finished. With his ass still hanging out, Cullen gets off his bed, tackles me into mine, and straddles me. A moment later I find myself on my back, with Cullenâs bare, fleshy ass mounds hovering inches above my face.
âI seem to remember you doubting the Cullen Canonâs power earlier today Joey, and I aim to show you otherwise. The Cullen Canon just k.o.ed my fart-slave and now itâs your turn. In you goâ
With that Cullen plants his big, fuzzy ass right on my face. Like Todd, I feel my face sinking in between Cullenâs fat globes. His doughy cheeks pour over the sides of my face, devouring my head entirely. Even with my head completely entombed in Cullenâs plump ass, itâs apparently not deep enough. Cullen starts working his hips above me, making my face sink deeper in between his bountiful globes. He finally stops when I feel my nose and upper lip press against his butthole.
âHey Joey, do you still doubt that I have enough farts to handle the both of you⌠HGHâ
BBBBBBBBBBBFFFFFFFFFFFFFWWWWWWWWWPPPPPPPPP
PPPPPPPPPPPPLLLLLLLLLLLLHHHHHHHHHHHHFFFFFFFFFFF
âAh, thanks for the burrito man, here, you can have a taste of my beef stew too⌠GGHâ
RRRRRRRRRRRUUUUUUUUUUU-PPPPPPPPPPPBBBBBBBBB
âOh yeah, Iâm brewing up something bad. Are you still glad you got me a burrito⌠NGHâ
PPPPPPPPPPWWWWWWWW-TSTSTSTSTSTSTSSS
Cullen keeps ripping one raunchy fart after another right up my nose. The atrocious stench of digested meat and methane is all I can breathe, and it has my lungs feeling like theyâre on fire. Even with all that, Iâve never been so hard in my life. I canât stop myself. I stick out my tongue and start lapping at Cullenâs sweaty, toxic-spewing, winking pucker.Â
Cullen starts moaning above me.
âOh fuck, no oneâs ever licked my hole willingly. Oh youâre definitely a keeper. I ainât gonna stop farting until you reek of my booty. After that everyone will know that youâre mine⌠NGHâ
RRRRRRRRRRRRHHHHHHHHHHHLLLLLLLLLLPPPPPPPP
FFFFFFFFFFFFFWWWWWWWWW-OOOOOOOORRRRRRR
PPPPPPPPPPPPPLLLLLLLLLUUUUUUUUUUUFFFFFFFFFF
âMmm, it seems like youâre gonna pass out. Your nose and the Cullen Cannon will become the best of friends after today, so donât worry. Weâll have a lot of smelly fun after tonight. Nighty-night⌠UGHâ
BBBBBBBBBBBRRRRRRRRLLLLLLLLLLAAAAAAAAAAPPPPPPPPTTTTTTTTTT
Cullen drops a series of massive butt bombs, pointblank in my face, obliterating my sense of smell. The putrid stench of raw sewage and spices is all I can breathe in. Cullenâs final fart is a true beast that lasts over 2 and a half minutes long. At the 2 minute mark I unfortunately pass-out.Â
SEVERAL HOURS LATER
BBBBBBBBFFFFFFFFF-OOOOOOOOOUUUUUUUU-WWWWWWWPPPPPPPP
Iâm startled awake by a series of loud eruptions going off in my face. Next, the stench of rotten eggs and garlic assaults my nose. My eyes shoot open, and a wall of gray dominates my field of view. Momentarily, I donât know what Iâm looking at.
FFFFFFFFFFFFFFFWWWWWWWWWWWUUUUUUUUUUUTTTTTTTTTTT
Everything comes back to me as another explosion erupts in my face. Iâm lying on my back, in the hotel bed, with Cullen squatting over my face. His shorts-clad, fat bum is right in my face, dropping butt bombs. Cullenâs noxious ass gas flows up my nose and has me coughing and gagging.
Cullen sighs in relief before hopping off my bed. I look at Cullen with watery eyes and he smirks back at me. âThatâs my way of apologizing for last night, Joey. I might have gone a tad overboard. You licking my asshole just triggered the possessive part of me. And I wasnât lying, I do wanna make you mine. But donât worry, not like Todd. I donât want you as a fart-slave, I want you in a more intimate way.â Cullenâs confession has my cheeks reddening.
âOh and Iâm also sorry about not farting on you anymore all last night. I spent the rest of the night butt bombing Todd, breaking him into being my fart-slave. And it finally worked, at 3 a.m. this morning, I did it, I finally broke him.â Cullen explains.
I glance around the room and see no sign of Todd. âUh, Cullen, whereâs Todd?â Â
âPlease just call him fart-slave when itâs just us Joey, he isnât a real person anymore. And I made him go get us breakfast, heâll be back in a bit.â Cullen says nonchalantly. He then looks at me with a cocky grin. âHeâs also working on a special gift for you and me.â
Iâm starting to feel pretty anxious. âAre you sure heâs just getting breakfast and not getting help Cullen?â
Cullen rolls his eyes, âNo joey, heâll follow whatever I say to the letter, trust me. He isnât the first fart-slave Iâve broken in.â
âI know I-â I pause as Cullenâs last statement dawns on me. I almost canât wrap my head around this. The day before yesterday, I used to see Cullen as the sweetest guy known to man. He was always nice to everyone and was always smiling. Maybe that was just a facade, and this version, this evil version of Cullen is the real one. A man who enslaves others with his farts.
âYou have other fart-slaves?â I ask breathlessly.
Cullen gives me a devilish grin as he starts to approach me with slow, small steps; he rips a sizable poot with every step.
âYes I doâ POOT âMy first fart-slave I made was my exâ POOT âWhen I found out that he was cheating on me I decided to tie him up and torture him the entire day with my fartsâ POOT âOnce I was finished with him, I accidentally wound up creating my first ever fart-slaveâ POOT âMy ex was a pretty smart guy so I make him do all my homeworkâ POOT âAnd heâll be doing all my college homework as wellâ POOT âNext, I decided to make it a complete setâ POOT âI found the guy my ex cheated on me with and turned him into my second fart-slaveâ POOT âHeâs got a car so I make him drive me wherever I wantâ POOT âHeâs my own personal chauffeurâ POOT âI make sure to fart in both of their faces multiple times a day, forcing them to smell my nasty butt vaporsâ POOT âMaking sure that theyâre frightened of the Cullen Canon, is how I keep them under my thumbâ POOT âAnd now Toddâs about to be my third fart-slaveâ POOT âHis rich folks are gonna pay for whatever I wantâ POOT
When Cullen reaches the bed, he climbs in and straddles my chest. I wheeze as he sits his meaty ass onto my chest, forcing the air out of my lungs. Cullenâs gazing down at me with a seductive smirk.
âOh Joey, if I were your boyfriend you would want for nothing. With my noxious butt bombs Iâd ensure that anything you desired would fall right into your lap. And all youâd have to do is show me and the Cullen Canon some love. However, thereâs a big risk. If youâre ever unfaithful or try stabbing me in the back then itâs over for you. Youâll join the others and become my fourth fart-slave. Knowing all that, whatâs your decision Joey?â
I already know Iâd never betray this farting god and in a way I already feel enslaved by his gassy prowess. Iâm already nodding my head. âYes Cullen, Iâd love to be with you. To be yours.â I declare.
Cullen grins genuinely. âExcellent, letâs make this official with a kiss on the lipsâ
With that Cullen spins around and pulls down the back of his shorts. I once again find his bare, fat, hairy ass hovering inches above my face. Cullen then reaches back and spreads his fuzzy cheeks before planting his cavernous ass onto my face again.
My face, once again, is swallowed up by Cullenâs voluptuous backside as he sits on it. But this time, I feel his winking pucker pressed right up against my lips. From above, I hear, âPrepare yourself Joey, the Cullen Canon is about to lavish you with its raunchy love. And we also need to build up your endurance. From now on this big fellaâs gonna be laying smelly smooches on your lips several times a day. NGH⌠Lucky you⌠UGHâ
FFFFFFFFFFFHHHHHHHHHHHBBBBBBBBBBBBVVVVVVVVVVVVVPPPPPPPPPP
A minute and a half of fetid ass wind explodes out of Cullenâs hole and vents into my open mouth. My cheeks inflate like birthday balloons the entire time. I can both taste and smell Cullenâs hellish butt fumes as it flows down my gullet and itâs overwhelming. As Cullenâs monstrous fart nears its end, I mercifully blackout.
I slowly awaken to the sound of a conversation. I lift my head and see Cullen talking to Todd, who has two plates of breakfast in his hands.
âSo did you do it fart-slave?âÂ
Todd nods his head, âYes master, my dad will be buying me a three bedroom house near campus and Iâll be sure to put it in your name.â
Cullen smirks, âExcellent work fart-slave youâve earned yourself a reward. Tonight youâll be sleeping under the covers while I Dutch oven you, but Iâll not be doing it bare-ass.â
Cullen looks over at me and smiles when he sees Iâm awake. âHey did you hear my present for us Joey? Weâll be living in a spacious, three bedroom house when we start college. One room will be our bedroom, the second can be our home gym, and the final room can be a place where I hold my fart-slaves when Iâm not using them.â
I smile back, âDamn, you and the Cullen Canon are already spoiling me.â I say lovingly.
Cullen smirks and gives me a wink. âIâm not done yet, I also ordered some breakfast.â
Cullen takes the plates of breakfast and hands one to me. He then looks down at his own and frowns.
âWhat the hell is this?â Cullen angrily demands Todd, as he points at the glass of orange juice.
âIt-itâs orange juice masterâ
âI fuckinâ hate orange juice! I told you that before you left!â
Toddâs shaking with fear. âIâm sorry master, I-I forgotâ
âYou didnât forget, you just werenât fuckinâ listening. Maybe somethingâs in your ear. No worries fart-slave I got a remedy for that.â Cullen grabs Todd by the shoulders and roughly shoves him to his knees. He then spins around, putting his bulbous rump in Toddâs face. Cullen then reaches back, twists Toddâs head to the side, and pulls the side of Toddâs face into his doughy ass mounds. Cullen lifts his left leg up slightly and grunts.
PPPPPPPPFFFFFFFFTTTTTTTTBBBBBBBB
Cullen rips a 4 second trumpeting fart right into Toddâs ear making him scream.
âOh you ainât goinâ anywhere. Congratulations, youâve earned yourself a gassy hour with the Cullen Canon, fart-slave.â
Cullen grabs Todd by the collar of his shirt and drags him to the corner of the room. Cullen sits Todd down in the corner, spins around, bends at the knees, and thrusts his bubble butt into Toddâs face, muffling his crying and pleading.
Cullen braces his hands on the adjacent walls and starts straining.
âNGH⌠Seems my fart-slave is in need of more training. Thisâll teach you to obey your master⌠FGHâ
BBBBBBBBLLLLLLLLLLLLLLL-WWWWWWWWWTTTTTTTTTT
I watch on in lust as Cullen tortures Todd with his butt fumes. I disregard my breakfast as I whip out my hard-on and start stroking myself. Iâve always seen Cullen as the nicest and sweetest person in the world; only to find out that behind closed doors, heâs a sadist who loves to enslave people with his noxious farts. And I think that makes him all the hotter.
Cullen notices what Iâm doing and smirks naughtily. Cullen brags as he keeps ripping ass in Toddâs face.
âYeah, keep stroking that cock babeâ PPBBT âIf youâre into farts then youâve found the perfect manâ RRRFP âIâm a fuckinâ farting godâ FFWWB âBefore noon Iâll have you shooting blanksâ PFFFR âBecause when Iâm done with him, youâre nextâ BWPPP âIâm gonna be destroying the both of your noses all day with my nasty ass gasâ FFPPB âHere take a listen to this, this is a preview of what youâre in for⌠UGHâ
Cullen proceeds to rip a booming, room-quaking fart in Toddâs face that makes me shoot my load.
BBBBBBBBBBBBBHHHHHHHHHHHVVVVVVVVVVVVVMMMMMMMMMFFFFFFFFF
The Role of the Hole
It was official. Some men became so vile and raunchy in body odor, that submissive sniffers became the new norm in society. These sniffers were a mix of horny volunteers, and unlucky citizens that fell into a life-long duty of inhaling whatever rank scents a man could produce. Tyler thought he had everything in life. He made good grades in school, he was first in his class and about to go into his final year of med school. As they studied the qualities of the âVile Maleâ, Tyler breathed a sigh of relief that he one⌠didnât contract the disease, and two didnât wind up as a sniffer for one of these vile stinky guys. âAs you can see class⌠this manâs sniffer looks to be a volunteer. See how erect he is?â The class oohed and ahhed at the manâs package. The man getting sniffed was sporting some wood as well.
âClass⌠what you have here⌠is not a volunteer. This is a new phenomenon recently discovered. This sniffer has been subjected to the smells of this guyâs B.O. for years. Eventually, the attraction to his stink was taught.â The professor called on a student with a question. âSo what you are saying, sir⌠is that this guy inhaled so many farts that his brain and sexual desires were completely rewired!?â âThatâs correct, Brian.â Tyler rolled his eyes after his adversaryâs inquiry. The two had butted heads all through college. Brian was determined to become a better doctor than Tyler. âOH GOD! The sniffer is flat lining!â It was always bound to happen eventually. Sniffers were intended to inhale as much odor as possible from this new breed of man in order to keep the air fresh for the remaining population. Eventually, their lungs would give out. âVolunteers!!! Volunteers? Any Volunteers?!â A nurse cried out to a room full of promising doctors. There was no chance that any of us would volunteer. That was until Brian grabbed Tyler by the shoulders and pushed him down the auditorium steps.
âGREAT!â The nurse ran out to Tyler and grabbed him hastily. It would be a huge tragedy if that manâs odor got out and spread throughout the college. The entire campus would be nuked with stink. Tyler was in tears. He didnât volunteer! His face was strapped to the same gas mask as the dead guy once used. The smell was awful. Worse than that? His smelly master gripped the top of his head, and pushed out a vile, wet, sputtering fart that traveled up the mask. BBBRRRRRCCHHHHPPPPPPPFFFFFTTT! âMMMMMMPPPPHHH!!!â Tyler screamed and gagged as the smelly guy laughed. âLooks like we got you a new sniffer just in time man!â The professor laughed. âOh yeah⌠well⌠I was told my sniffer had pretty weak lungs, and to go easy on him for a bit⌠looks like he just couldnât take it anymore⌠I sure do have a ton of gas left thought⌠so yâall are lucky I was able to hold it all in until I got this new fella!â He rubbed his tummy and blasted another fart that went straight into Tylerâs nostrils.
âFuck! Tylerâs already hard!â Brian and the class laughed at their former classmate. Tyler was embarrassed⌠he had suppressed these feelings and STILL he wound up as âone of themâ. âI think Iâm gonna like you man⌠weâre gonna have fun tonight⌠Iâm having chili!â The vile man winked. Tyler was carried away in restraints and was forced to follow his new master on his knees. âSmell that cheesy crotch man? I never shower⌠and honestly when I do it donât do me any fucking good.â Tyler cried as his cum dripped into his shorts. His new life as a sniffer was going to be hell.
Let this serve as a lesson, homo. Always respect your superiors. Now I wanna hear big sniffs, go onâŚ
You were on vacation with two of the biggest douchebags in your fraternity, Chase and Blake made sure to fuel up on the way up. You were the driver and had to stop at every fast food place for these guys. They stunk your car up so bad and you werenât able to unlock the windows or else youâd be underneath there ass all vacation. When you all got there they went out to the deck. They called you over and unleashed a giant barrage of smelly farts right in your direction. âHahaha smell that fagâ. They grabbed you and dragged you into the bedroom. The night was a complete blur, all you remember was waking up under both of their bare asses. BBBBLLLLRRRRPPPP âsniff that rip and go back to sleep bitch, we arenât done with youâ.
Nostalgia Trip (Commission)
(Contains: M/M, Farting, face/mouth-farting, kidnapping, bullying, age-gap, non-consent, foot licking, poor hygiene, mild scat, references to underage.)
[DARREN]
Darren couldnât believe his eyes. Heâd travelled down to his alma mater to help him son get settled in for his first semester, and who should his boy be rooming with, but his good olâ fart sniffer Luke? Only, it wasnât Lukie Boy, it was some guy named Jordan, whoâs his absolute spitting image. He had to brace himself on the cheap dorm desk. He felt like heâd fallen through some sort of time rift. The boyâs hair was a bit longer, and his face a bit sharper due to the added couple of years, but other than that, the young man in front of him could have been Lukeâs doppleganger. Same straight brown hair, pale skin, full lips, blue eyes. Same skinny but tall build. The sort of Nancy boy who deserved to be put in his placeâused by real men.
Keep reading

Anya is live and ready to show you everything. Watch her strip, dance, and perform exclusive shows just for you. Interact in real-time and make your fantasies come true.
Free to watch ⢠No registration required ⢠HD streaming
NOT MY STORY JUST SOMETHING I LOVE THE IDEA OF:
John was sitting at his armchair in his living room, thinking for a long while. Would it work well? He thought it would. He looked up at the clock and saw the time. It was a quarter to 3. If the guy who emailed him was serious about this, he would be getting off the train at 3:15. John got up, grabbed his coat, and left his house.
The train pulled into the station. People got out. John sat in his car, waiting for the guy who had reached out to him. He stepped off the train, just as he said he would. He was short, a scrawny nerdy looking guy with blond hair and glasses, not too shabby an outfit. Sweater over a shirt and khakis. He was probably a tech guy. He was scanning the parking lot for Johnâs car, and when he saw it, he paused. Maybe he was second guessing? Whatever nerves had caused him to pause, he dropped them and walked toward Johnâs car, a slight tremble in his steps. In that moment, John felt the urge to fart. He held it in. Johnâs cock was hard in his pants.
âBen?â He rolled down the window.
âYeah, John?â He gulped.
âCome in.â
He got into the car and buckled his seatbelt, âThanks for picking me up,â
âYeah of course. Besides, no offense, but I donât give my address out to people who might flake.â He turned out of the parking lot, âYou still want to do this?â
âYeah,â Ben was smiling wide. He thought John looked even hotter in person; rugged black hair and scruff, a strong physique...he had seen naked pictures and knew he was hairy under those clothes.
âGood. Do you want lunch or anything?â John gave out a little laugh, âWill probably be your last good meal for a while,â
âNo itâs ok, I ate before I got on the train,â Ben was shaking now. John grimaced. He didnât want to bring this stranger to his house if he started having doubts and backing out. But there was not much he could do. In the email, he was clear that Ben was allowed to say no at any point before they start. After they started, Ben would have no choice. That part turned Ben on, heâd said.
They reached his house. It was an ordinary single story house. It didnât stand out from the others in the neighborhood. It had a chimney, but John didnât use the fireplace for years.
âYou know, Iâm still surprised that you found my ad,â John said as they got out of the car. âI thought that site would have taken it down by now.â
âNope, itâs, uh, still up.â Ben had gone quiet in the car. John could tell he was nervous. Once they got into the house, Ben asked âOk so, where is it?â
John smiled again. Maybe the nerves were because of excitement. âFollow me.â
He brought him into the living room. It was relatively small. His armchair was against one wall. The couch was against the other. Three large windows looked into the back yard. Across from the armchair was the TV. John gestured toward the armchair, âHere it is, just like I told you.â
Ben was trembling a lot now, and he looked at the chair, his eyes glued to the seat. âIt really works the way you said, in the email?â His voice was faint.
âYep. Iâll go over just to be clear,â With a grunt, he pulled the chair away from the wall. Ben couldnât believe what he was looking at. It was exactly as it was in the pictures. The same pictures he had been jerking off to for the past week.
It was a large square hole in the wall. John had explained that it was where the fireplace used to be, but he didnât want to pay extra for gas so he had it removed. Instead of patching up the wall, he left the hole. Heâd also done a lot of DIY. He expanded the back of the wall, which took some space out of his bedroom closet but he didnât mind that. He built a small drain that went down into the houseâs sewage pipes. Just above that was a long board with wheels, what resembles a hospital gurnee. There were straps around it. There was also a hole in the middle of the board.
âAlright,â John sighed, his arms on his waist, âSo...to recap. Youâll lay down here. Iâll strap your arms, ankles, legs, and chest in so you canât move. Youâll be naked and your ass will go in that hole. Iâll put a funnel system around your dick and under your ass. That way, you donât have to come out for the restroom or anything, you can just go into that hole. Kind of gross but it takes care of that problem at least.â
Ben gulped, âOk,â
âYouâll be completely strapped and so, wonât move around. Then, Iâll put the chair over you. As I showed you,â He gestured toward the back of the chair, the bottom of it was hollowed out, âI fixed this old armchair up so that the cushion has a rim-chair built into it. When I put the chair back in place, I will turn the knobs on the gurnee and it will lift you up so that your face is at the seat level. See?â He unveiled the top of the seat, which looked like a normal cushion at first but turned out to be a thin fabric hiding the rim-chair. âYour face will be in that hole. And...uh, yeah thatâs it. Iâll sit on your face as long as I want.â
Benâs heart was pounding. John continued, âThis fabric is in case I have friends over. Which I will, tomorrow night. I invited some buddies to come watch the game. Donât worry, none of them will be sitting in this seat. Your face belongs to my ass only,â He smiled wide, âJust as I said in my emails, when you are my chair, you have no rights. You cannot say you want out at any time. If I need to fart, Iâm farting up your nose. If I want my hole licked, Iâll sit on you naked and that will be your only cue. The only time you matter is when I ask if you are hungry or thirsty, and Iâll give you food and water. Otherwise, you donât give me instructions. Iâm not interested in conversation, because I donât talk to chairs. If you are uncomfortable and want me to loosen the straps, too bad. If youâre sick of my farts, too bad. As we agreed, you belong to me for the next 48 hours. There are no safe words. If you want out now, Iâll take you back home. But the minute I put you in the wall is the minute you belong to me. If at any point in the next 48 hours you want to stop, and go home...too bad. My ass is your home until the weekendâs over. Do you understand?â
Benâs face was white. Heâd been jerking off to this kind of fantasy for so long, and when he found Johnâs ad online, he couldnât contain his excitement. But now that he was in the house, he was terrified. It was too real for him. What if he hated it? What if in the very first minute he hates it after all? Heâd never done something like this before. Heâd never actually been smothered under a manâs ass, heâd never sniffed farts, never done anything kinky like this. If it turns out he doesnât like it...heâll be stuck as a human chair for two days.
âDo you understand?â John was deliberate.
âYes sir,â Ben gulped, âI...Iâm sorry this is just so hardcore...Iâve heard of people doing these things but I havenât really done BDSM stuff with anyone,â
âDo you want to call it quits?â John asked again. âI wonât be mad.â That wasnât entirely true. He would be annoyed and disappointed if the only person who responded to his ad decided to say no at the literal last minute. Heâd been dying to try out his new toy for months. But he was still a good guy. He wouldnât pressure anyone into doing it. In the emails, Ben seemed very excited. Maybe he was more in love with the idea of being a human chair than actually doing it. John would cut him slack since he has never dipped into bondage play before.
And Ben was nervous. He stared at the hole for a long time. The silence was more awkward with each passing second. Finally he took a deep breath, âNo, I...Iâm ready.â
âOk. Take off your clothes.â
Ben stripped. As he undressed, his face was flushed. John seemed like a nice guy over their email conversation. But how could he put so much trust in a stranger on the internet? The only solace that Ben had was knowing that in these last few moments before they started, he was in complete control. At any second he could say âNopeâ and go back home. But that window of time was getting smaller and smaller. John had pulled the gurnee out from the hole in the wall. There were seven straps. Two for each ankle, two for each wrist, one for his thighs, one for his chest, and one for the neck. There was a little padded indent at the front where his head would rest, two little rounded poles came up on either side. He didnât know what they were for.
âAlright, if you are ready, lay down on your back.â
Ben stood in the living room naked. His cock had gone hard and was throbbing. He knew that once he was strapped in, he wouldnât be able to touch himself at all for the whole weekend. That was part of the fun.
âAnd Iâll take your glasses for you,â He said. Ben took them off and handed them over. John asked, âcan you see at all without these?â
âA little,â he shrugged, blinking, âI canât see far away.â
âOk. Not that it matters, you wonât be looking at anything but my asshole.â He picked up Benâs clothes and put them on the table.
Ben sat down on the gurnee and got into position. Laying down, his ass was over the hole. When he had to go, he would just relieve himself into the tube that John would set up. That was the worst part, to him in the moment, thinking how disgusting and unhygienic it was. But he wouldn't have another choice. John had suggested wearing an adult diaper, but that sounded even worse.
Ben tightened the straps around his ankles. Then he tightened the strap over his thighs. Then, around his wrists. Benâs heart was beating too fast. He tried to control his breathing. John tightened the strap over his chest. Almost as a reflex, Ben jerked his body a bit but he couldnât move at all. Delicately, John guided Benâs head down on the padding, and carefully wrapped the strap around his neck and tightened it just enough to keep him from moving his head up. Ben gulped, he felt the strap. He could still breathe fine at least. John moved over to fit a large tube over Benâs dick, and pointed the other end of it down the hole in the gurnee between Benâs legs. He set up a similar tube under Benâs ass. Then, John turned some knob near Benâs head, and the two poles on either side came together and pressed into his temples just above his ears. They werenât tight, but they were set in place so Ben couldnât turn his face to the side. He was completely immobile.
âAlright. This is your last chance,â John stood over him, his crotch was at the level of Benâs face. From here, Ben saw John at a glorious angle. He looked so tall, buff, powerful, a dominant man. âAre you absolutely sure you want to go through with this?â
Ben nodded as much as the poles and straps allowed him to, âYes sir. I...I need to be your chair. Itâs my destinyâ Benâs cock was throbbing against his belly.
John smiled widely. His crotch was bulging. He had been horny since they started talking online. âYou have no idea how much Iâm going to love this. This has been my fantasy for years but I couldnât find guys who were into it. Youâll be my first chair. You should be honored.â
Ben gulped, his face was burning red, âI...Iâm very honored sir. I hope I serve you well.â
âYou only have three jobs once youâre in there,â John said, âFirst, sniff all of my farts. I donât want to smell a single one. Second, eat out my asshole whenever Iâm naked. Third, donât talk unless you are asking for food and water.â
â...ok,â Benâs voice had gone weak. He was starting to feel dread now. Excited and horny, but also dreading if heâd made the wrong choice. But it was too late to say anything. He had to go through with it. As he said, this weekend is his destiny now.
It was settled. John slowly pushed the gurnee into the old fireplace, lining it up right. He had sealed off the chimney long ago, so it wouldnât be cold in there. Benâs body was completely hidden in the wall. Only his head and shoulders were sticking out, held down on the gurnee. Using his feet, John kicked down the wheel stops so that the gurnee couldnât move if Ben shook around. John then pushed the chair back in place against the wall. Then, he got on his knees and stuck his hand under the chair. He found another knob and twisted it a few times to lift the gurnee up. As promised, Benâs nose peaked through the hole in the seat. John stood up, and saw through the built-in rim seat, Benâs face was the only part of him exposed. John grabbed the fabric from earlier and reminded him, âThis is only to cover you for when my friends are here tomorrow. Donât worry, they wonât see you. But it is thin enough that my ass will mold over your face and you will still get to smell everything.â
âUm, John,â Ben was shivering, âcan we...or, ok, wait, pause, can we just do this for maybe half an hour at first, just to test it so I can see what itâs like before we do the full two days,â
John burst out laughing. It sounded evil in the moment. Benâs face went white this time, the same dread creeped back. John said âI just told you minutes ago that donât have conversations with chairs. No normal person speaks to a chair. But since youâre new to this Iâll let it slide. Your time for negotiation is over. If you wanted to only do half an hour, you should have said so in the email. But nooo...youâre pathetic little dick was throbbing when I said 48 hours. Remember you told me that? Throbbing. You loved the time we picked. So Iâm sticking with it. It is,â he looked at the clock, â4pm Friday. Meaning that you will be here until 4pm Sunday afternoon. And now Iâm done talking to you.â He sighed. Ben was whimpering. He was afraid heâd made a terrible mistake.
âI have been holding this fart in since I picked you up from the train,â John smiled again, âAnd youâre going to vacuum suck it out of my jeans.â he turned around. His ass looked huge from this angle, and he slowly lowered it over Benâs face. The cushion supported his butt cheeks, and lightly spread them in his pants. They molded over Benâs face. John shifted around until he felt the tip of Benâs nose wedge up against his asshole. Now John was shaking. His cock was hard. He gripped the armrests of the chair and pushed.
PPPPPPRRRRRRRRRRRRR
The fart came out much louder than he thought it would be. It vibrated deep into the chair. He burst out laughing. He felt Ben cry out into his ass, and he heard the gurnee wheels squeak. He was buckling around down there, making the gurnee shake a bit, but John knew it wouldnât move. And he knew that there was nothing Ben could do to get his face out from his ass. The straps and post made it so he had no choice but to keep his head up, and if John wanted to fart directly into his nostrils, he could. And definitely would.
âAgain, Iâll be nice since youâre new to this,â John cleared his throat, âYou canât be making any noise down there. The next 24 hours will be great practice for you to suck in my farts without freaking out and screaming.â
He felt Ben settle down, and felt him sniff and cough into his ass cheeks. John said, âOk and also you really need to not cough or gag or anything. Anyway, now we can start for real.â
And with that, John stopped talking. Because why would he talk to a chair? He flipped on the TV and watched an old sitcom rerun. He felt a silent but deadly fart seep out and warm his butt. He shivered in delight, feeling extra comfortable in his new chair. If anyone else lived in the house with him, walking by they would just see John sitting in his favorite chair watching TV, and not think twice.
âŚ
The next couple hours were uneventful. The sun set and it got dark in the house quick. John had some lights on and was still watching the show. At one point he got up to grab a bag of chips. As he stood up, he heard his chair coughing and sucking in fresh air. John laughed. In the kitchen he poured some chips into a bowl. Then he walked right back to the living room and sat down. Obedient so far. He didnât have that much gas. Just a few short, quiet farts whispered out of his ass. They must have stunk pretty badly because each time, he felt muffled coughing against his butt cheeks, and heard the gurnee shake a bit. John had a huge smile on his face, and he was hard the whole time.
At around 7pm he turned off the TV, got up, and went to the kitchen to make some dinner. Nothing special. Leftover beef tacos. Even though it wasnât healthy for him, he heated it up with a heaping handful of pre-shredded cheese. His grin was so wide. Heâd mentioned in earlier emails that he was lactose intolerant, and that he would purposefully eat dairy so that he had more frequent and more foul smelling gas. In Benâs reply, he said âmy cock is drooling at the thoughtâ. So, why not stick to his word? Heâll feel gross for the rest of the night, but at least John wouldnât have to smell any of his own farts. He quietly ate his tacos in the kitchen, texting his friends about what beer he should get for the party tomorrow.
Closer to 8pm, he came back to the living room. He wanted so badly to look down at his chair again, but part of the fun was not acknowledging Ben as a person. He had to treat the chair like he would treat any other chair; with apathy, and disinterest. He sat back down, shifting a bit and feeling his cheeks separate so that Benâs face wedged into his ass again. He puckered his hole to make sure that it was right over his nose.
âUgh, I shouldnât have put cheese in those tacosâ he pretended he was talking to himself, âMy ass is gonna be ripping up a storm tonight.â
He sat back and turned the TV on again. This time he watched the next episode of his favorite cop drama.
His guts gurgled. His dick got hard. He knew that his chair had heard the gurgling too. John could feel his face scrunch up, embracing for impact. He grunted,
PRPRRRRRT
A wet sounding fart sputtered out of his ass. John sighed. He felt the chair sniff, and then it made a violent gagging noise. Again, he felt the chair shake a little as Benâs body jerked as a reflex. John held back laughter. His own lactose farts made him feel queasy. He couldnât imagine how unbearable they had to be injected right up the nose. He looked at the clock. Only 45 more hours to go.
At 9pm he got up, and to his surprise, the chair spoke,
âJohn can we do a time out,â
âHuh?â He looked around, pretending that he was alone, âThatâs funny, I could have sworn I heard someone speak even though thereâs no other human in the house,â
âJohn Iâm serious,â the chair pleaded, âYour farts stink really fucking bad, I need a break,â
John grit his teeth, and said, âOk, quicktime out. Yeah, of course they stink. Theyâre farts. Not rose perfume. Second, you donât get breaks, remember? You are my chair.â
âYeah,â Benâs voice was faint, defeated. Theyâd already talked about this at length over email, but it wasnât until that moment that Ben had internalized the reality of it.
âNow, Iâve been way too nice to you so far,â John continued, âSo if you speak without permission again, Iâm not going to be nice. Ok?â
The chair didnât say anything.
âGood chair.â John nodded. âYou hungry?â
âYes sir.â
John went into the kitchen to make food. Ben stared up at the ceiling, his whole body trembling. This was really happening. He couldnât stand Johnâs noxious farts. Each one made him feel sick to his stomach. But he had no choice. Just as he promised, he was completely at the mercy of Johnâs ass. In the dark hole in the wall, a pearl of precum dripped out of Benâs cock.
John came back with bowl of tomato soup and a grilled cheese sandwich. The smell of tacos when John got up earlier had made his stomach growl, and he wished he would have gotten more food than this. But he couldnât complain. John had to spoon feed him the soup, and he tore the sandwich into small bites to drop into his mouth. Didnât want to get the rest of the chair dirty. He then let Ben gulp down a glass of water.
Without asking if he was satisfied, John sat right back down in the chair. He had a devilish smile on his face, because he had been holding in more gas since he got up.
PRRPTRTTTTTTTTT
The fart sounded like it came from deep in his bowls. Again, he felt the chair jerking around under him. He continued to watch TV.
Close to 10pm, John turned the TV off and got up. He went into the bathroom, got undressed, and turned on the shower. He stood outside, waiting for the water to get hot. His body was covered in black hair, especially on his arms, legs, and ass cheeks. He got into the shower and started to shampoo his hair. He rinsed, put in some conditioner, and lathered his hands in body wash. He kept his ass sticking out of the shower curtain. He didnât want a single drop of water to touch it. Why wash your ass in the shower when you had a chair with a built in asshole cleaner? Out of curiosity, he did two things. First, he brought his ass back into the shower, still away from the water, and ripped a fart. It echoed off the tiles. He sniffed the air. It was like old cheese in rotting egg salad. The stink actually made him gag. He started laughing. That was what he would be feeding his chair for the next few days. His cock was hard, but he decided to wait to take care of it.
The second thing he did, after he dried himself off, was to rub his index finger in his ass crack, then bring it up to his nose to smell. Not atrocious, but not...good. Itâs a manâs ass at the end of the day, of course it wouldnât smell good. Again he shivered. He washed his hands, then he brushed his teeth. He went into his room, still naked, and grabbed a blanket. Then he walked back to the living room.
His cock had gone down a bit, but it was at half mast when he reached the chair. Briefly, he looked into Benâs eyes, before turning around and sitting down. Now he felt the skin of his face wedge into his ass crack. Luckily he didnât have to repeat the rule about nudity, because the chair remembered to start licking. John draped the blanket over himself, and opened a book he had left on the table.
For the next few hours, John was in ecstasy. It was so warm and comfortable. He loved the feeling of being fresh out of the shower, comfy and naked in a blanket, curled up with a good book, and feeling a hot moist tongue work his asshole. It was hard for him to focus on the book, because, despite how much he wanted to dehumanize and ignore him, Ben was the only thing on Johnâs mind. He thought that at any moment, he could easily fart into his mouth. But it was still day one, John thought heâd give him a bit more time to get used to these arrangements before he pushed the boundaries. The devil on his shoulder was excited. He couldnât wait until tomorrow, when he would get to hear his chair gagging on the fart heâll rip down its throat.
As the hours passed, the tongue was moving slower and slower. There were a few minutes where it stopped completely. John would clear his throat, and a moment later it would start back up again. He looked at the clock. It was nearing 1am.
8 hours had passed. Another 40 to go. John wished he could just fall asleep in his chair, and force Ben to endure his night farts. His dick was hard at the idea of him being fast asleep, and his unconscious body letting out a disgusting fart right up Benâs nose. So badly, he wanted to sleep on top of Ben, keeping Ben from sleeping and forcing him to be conscious with his putrid asshole over his nose. But unfortunately, John couldnât fall asleep in a chair. He had to lay down. So, he put the bookmark in his book, set it aside, tossed the blanket off of him, and got up to go to bed. He stood up a bit, his ass hovering just over the chair. Instead of saying goodnight, he grabbed his ass cheeks, spread them, and pushed,
PPRRPRPRPRRRRRR
Yet another obnoxiously disgusting fart burst out of his ass. This time, he got to hear the chairâs coughing and gagging without being muffled. He didnât turn to look. He turned off the light and left the room.
In bed, John had lotioned his cock and was masturbating to the memories of the day. He was kicking himself for not modifying the couch instead. If heâd modified the couch, then he could have the option to sleep with his ass over Benâs face. Ribbons of cum draped his body. He wiped it off with a rag and fell asleep.
âŚ
At 7am, Johnâs alarm went off. He yawned, stretched, refreshed for a new day. He got out of bed and threw on tight athletic underwear that helped him breathe down there, grey jogging shorts, and a tight purple running shirt. He put on black socks, and his running shoes.
Walking through the house, he passed the living room on the way to the kitchen. His chair was silent. He grabbed a water bottle out of the fridge, grabbed his iPod, and left his house.
Even though it was a cool morning, he sweat a lot during his run. He jogged three miles every morning. His stomach wasnât feeling good. Still upset from the cheese the night before. But that was a problem for his chair to deal with.
It was closer to 8am when he got back to the house, his back, armpits, crotch, feet, and ass were all sweating. He finished his water and came into the house, where he took off his shoes, and, with a smirk, dropped his jogging shorts. His underwear had dark patches of sweat around his ass crack and crotch. He walked straight to the living room, ready to relax in his chair.
Briefly looking at the face in the hole, he noticed bags under his eyes. He thought about asking Ben if he slept well, but remembered that it would be weird for a guy to talk to a chair. Ben hadnât slept well at all. He never was able to sleep on his back, and hours of the straps digging into his skin made him itchy, and the inability to move made him claustrophobic. He briefly slept for a few minutes at a time, dozing off then waking up again, unable to fall into a deep sleep.
John twisted around and sat on the chair. His tight underwear held in the moisture of his ass crack sweat up against the nose. John leaned forward, scrolling through social media on his phone. He slowly let out a thick and silent fart. It made his swamp ass heat up, and again he heard and felt retching under him. Johnâs cock tightened.
After a half an hour of aimlessly looking at sensationalized news, John got up and went to the kitchen to make breakfast. He scrambled some eggs and put them in an english muffin sandwich, each with a slice of ham and muenster cheese. He figured the combination of eggs and cheese would make a wonderful cocktail of gas for his chair to enjoy later.
He went to the living room and asked, âHungry?â
âYes sir,â the chairâs voice croaked, sounding depressed.
John went back to the kitchen. A few moments later, he came back with some buttered toast, a cup of greek yogurt, and a banana cut in slices. Feeding was the only time he treated Ben like a person. John looked down at him with a kind smile.
After giving him a glass of water to drink, the chair said, â...Iâm sorry John but I feel so stiff. Can you let me out?â
Johnâs smile disappeared.
âJust five minutes and Iâll get right back in,â the voice was shrill, âPlease, I gotta stretch man, this hurts,â
John didnât say anything. He set the glass down, stood up, and left the room. Benâs eyes frantically shifted, but he shouldnât move his head to see anything beyond the ceiling. He heard Johnâs footsteps come back, and then, to Benâs surprise, he felt the gurnee lower. He was going to let him out!
âThank you so much sir,â he smiled, âI promise I wonât complain again for the rest of the weekend,â
John moved the chair out of the way. But instead of pulling the gurnee out of the wall, he stood over Ben and twisted his ear. Ben cried out in pain, his face scrunching up and his mouth wide open. Just what John wanted. John quickly shoved something into Benâs mouth, and quickly wrapped a strap around the back of his head, keeping it secure around his mouth. Ben couldnât see it, but he could feel it prying his lips open. He couldnât close his mouth if he wanted to. He moaned out, frantic. What was going on?
John ignored his cries, and he brought the chair back over him. Then, he reset the gurnee to lift him back up to seat level. Just like before, except this time his mouth was being held open with a spider gag.
The chair continued to moan in fear as John went into the kitchen and pulled out a half pint of chocolate milk. He chugged half of it, then carried it into the living room. He stood over the chair so it could see clearly what he was holding. Itâs eyes were wide with fear. It moaned out, unable to make words but the pattern was clear, âNo, no, no, no,â
âI told you I would stop being nice if you didnât keep silent,â John closed his eyes, setting the milk jug down. âNow, you must be punished.â
He turned around, peeled his underwear off his sweaty ass cheeks, pulled them apart, and sat down on the chair.
PRRRRRRRRRRRRRRRRRRRRR
The chair screamed up Johnâs ass. John smirked. That had to taste bad. It would take another hour for the milk to do havoc on his system, so he would just have to wait until the real punishment started. John turned on the TV and relaxed.
âŚ
At 11:30, John finally stood up. He looked down at Benâs face, which was wet with tears, and his eyes were burning red. Despite how horrible the past three hours had been for him, he at least managed to swallow every single fart.
Without speaking, John lowered the gurnee, moved the chair, and then removed the spider gag. The chair didnât speak. Just like a good chair should act. He then put everything back in place.
John hoped that Ben finally understood what âyou have no rightsâ means, and "you belong to me for the next 48 hoursâ. He looked at the clock and did a quick calculation. 20 hours in, only 28 more to go.
He went into his bedroom and changed into jeans and a plain sweater. Grabbed his coat, wallet, and keys, then left the house. He drove to the grocery store. It was busy around lunch time. He picked up snacks for tonightâs game. Buffalo chicken wings with blue cheese dipping sauce. Nachos. Mozzarella sticks. John grimaced. The milk he drank earlier was making him feel bloated and queasy. As bad as he felt, at least he didnât have to experience dozens of his lactose farts directly on his tongue. He shuddered at the thought. Even so, he felt reluctant to get all of these cheese products. He shrugged. He always took one for the team. If his friends were over, heâd treat them to all kinds of unhealthy cheese covered snacks. And again, it isnât as if any of them would have to smell his farts. That was the chairâs job.
He bought a case of generic beer. Then, he decided for himself to grab a six pack of stouts. These heavy dark beers made his ass bloated at night. Since itâs day two, he should bring out the big guns and make full use of his fart-vacuuming chair.
When he got back home, it was a little after 1pm. While he was gone, Ben managed to doze off a bit, only from exhaustion. And boredom. The worst part of this weekend so far was the incredible boredom he felt.
John put everything away, and he left the wings in the oven on low heat. He came back with lunch for the chair. Just a ham sandwich. As he fed the chair, he said out loud, âMy friends will be coming around four. Iâve been feeling so bloated and gassy today. Thankfully my new chair will take care of that. Iâll let them out silently, and it will silently vacuum up my farts so no one has to smell them.
The chair let out a whimper.
âŚ
By the time his friends came, John had changed into sweatpants and a loose comfortable sweatshirt. Matt and Hugo gave him bro hugs, and they all walked toward the living room. From their view, the chair was plain as ever, a normal looking seat, unremarkable and not worth looking at twice. John had already set up the nachos. They all grabbed beers, John opted for his bottle of stout. He sat down in his chair and relaxed, taking a deep swig of the bottle. The three of them chatted about work, Hugo vented about his girlfriend, they watched the game and talked about stats, they munched on nachos, they made dirty jokes. John felt his stomach cramp a bit, and so he carefully let out a silent stream of gas. It felt very hot, and it warmed up his butt and the seat of the chair. The heat went away quickly at least. The chair was working. John smiled.
Later, he got up to bring in the wings. As he got up, he smoothed out the sides of the chair to fix any suspicious indentations. For a split second, the seat seemed to be in the shape of a human face. But neither of the friends noticed, because, well, why would anyone pay attention to a chair? In the kitchen, John pulled the wings out of the oven. His stomach still felt sick. The milk from earlier was still bothering him, plus the new addition of nacho cheese. The beer wasnât helping, and if he dipped fried chicken wings into a cheese sauce...He closed his eyes. It would be very hard for him to hide his gas. But he had to be a good host.
The night went on, and the more drunk they got, the louder they got. They laughed, they cheered. John was so comfortable in his seat. He slowly let out what felt like the hundreth fart of the night. Again, he felt his ass warm up. And again, he felt the slightest nudge underneath him.
âDude should you be eating all this cheese?â Hugo asked.
Matt laughed, âOh yeah, doesnât this shit give you like mad farts and stuff,â
âHah, yeah,â John shrugged, âTo be honest Iâve been farting into my chair ever since I sat down.â
They all started laughing. He went on, âSeriously, it isnât even like a bunch of farts, for the past hour itâs been one long stream of gas. Iâm still letting it out.â
Hugo was on the verge of tears.
âDonât worry, my chairâs been absorbing it all,â
âŚ
After the game ended, they sat in the living room, chatting some more. Finally, it was nearing 10pm, and they decided to head out. âYou wanna come out to Nicoâs with us?â Their favorite bar.
âNah, Iâm good. Iâve been exhausted I think Iâll just watch some TV then head to bed.â And he genuinely was feeling sick to his stomach.
He saw them out. Then he returned to the living room and stretched. He saw that he forgot to adjust the fabric the last time he got up, and so the indentation of a face was clear on the seat. John was surprised that none of them had noticed. His dick was getting hard. He walked over to the chair and took the fabric off. Ben took a gasp of air.
âThirsty?â
âYes sir,â he coughed.
He went to get a glass of water. He wanted to congratulate Ben on a job well done. Five hours worth of farts went completely unnoticed because of him. But it would be strange to thank a chair for doing something itâs supposed to do anyway. And it isnât as if a chair would feel something like pride in being a fart absorber.
After giving Ben some water, John sat back down. His eyelids were heavy. He watched the TV some more. He realized he was falling asleep. He got up, went to the fridge, and pulled out the fourth bottle of the night. Not a whole lot, but enough to make his body feel heavy. He got an idea. He was trembling with excitement, but he couldnât think about it too much or the plan wouldnât work. He opened a drawer and took out a roll of duct tape. Back in the living room, he set the bottle on the table next to his chair. Then he pulled out a strip of duct tape, and used it to cover the mouth in the chair. Then, he turned around, and slowly lowered the back of his sweatpants. His hairy ass hung out of his pants, and he slowly sat down on the chair, adjusting so that his hole was over the nose as usual. He yawned. He drank the beer and watched the TV, lowering the volume. After another hour, without trying he fell asleep.
âŚ
It wasnât until the early hours of the morning that Ben realized, with horror, what had happened. That John had fallen asleep with his disgusting unwashed asshole against his nose. Without being able to open his mouth, he had to breathe through his nose, which meant he had to take in his stink with each breath. The weight over him made it difficult to breath as it was.
When he first farted, Ben thought that John was awake. The fart made his eyes burn, and he gagged against the duct tape. Then he realized that John was completely asleep, and that he just farted in his sleep. They were soft, but thick and hot and swampy. The combination of lactose, beer, and deep fried foods, made the stink beyond atrocious. Another fart seeped out of Johnâs ass. Ben gripped the sides of the board, and wiggled his feet, and tried shifting his body around. There had to be some way to turn his head to the side so he didnât have to suffer it. But everything had been planned out too well. There was no escape. The asshole was providing him his only air, and so it was the only thing keeping him alive through the night.
âŚ
At 7am the next morning, the alarm in Johnâs room went off. He could hear it from the living room. He had a bit of a headache, and his mouth was dry. He saw the TV was still on, low volume. The morning news. He drifted in and out of sleep for a bit.
Almost half an hour later, he opened his eyes again. He felt sweaty. Uncomfortably sweaty. It was warm in this room, and the sweat clothes were really making him sweat. He knew his hairy ass was coated in sweat, and the face pressed up in his ass crack also felt uncomfortably hot. John smiled. He couldnât imagine how horrible the night had to have been for his chair. He grunted and let out a beastly morning fart.
PPPPTPRPTRPTRPTRPTRPTPPSSSS
Yep. Definitely a beer fart. He felt shifting underneath him. Good, his chair survived the night. He stayed there for a bit so the chair could absorb the gas.
He stood up, peeling his cheeks off the face, and yanked the duct tape off. The chair cried out in pain, and then started gasping. John ignored the noise and walked to his room, his ass still hanging out, red marks from where it had been rubbing skin all night.
He took off his clothes, went into the bathroom, and took another shower. Again, he kept his ass out of the curtain. He thought it must have looked funny from an outsider perspective; a man taking a shower with his ass sticking out.
Usually he went for a run, but he wasnât feeling good. His stomach was still a wreck from the night before. Only 7 more hours of fun. He didnât put on a shirt, but he did put on a pair of basketball shorts.
He went back to the kitchen and made a bowl of oatmeal. He fed the chair without speaking to it. The chair didnât say anything, it greedily ate the oatmeal off the spoon. Even though John knew it would make him feel worse, he poured himself a bowl of cereal with milk. He brought his cereal into the living room and ate it while watching the news from his chair. His stomach hurt in the next half hour.
SSSPPPPPPPRPRPRRPRPRPRR
The fart was painful, and sounded ugly. John cringed and held his stomach. He wanted to take one of his emergency gas pain relief pills, but that would probably stop his gas for the rest of the day. He only had 6.5 hours of fun left with his chair, and he wanted to make it happy. So he bore the pain, and pushed out the next fart.
PPRRTTRTRTRTRPTPRTPRTPRTPRTPRPTRPTPRTP
The chair was working overtime to suck in these farts. John was surprised he still felt and heard gagging underneath him. Youâd think after so much time, the chair would get used to it by then.
A wicked thought came to Johnâs mind. Heâd had it before when he first messaged Ben, but he didnât take it seriously. But he thought, what if he just decided to keep his new chair, and ignore any previous arrangements. Of course the thought was just a fantasy, he couldnât actually do that to Ben. But it made his balls tighten.
âŚ
He didnât do much the next couple hours. As usual, he watched TV, and unleashed his upset-stomach farts into the seat of the chair. He couldnât imagined what they must have smelt like. And thanks to the chair, he would have no idea.
At lunch, he just had a sandwich. He fed the same type of sandwich to the chair, and gave it water. Then, he sat back down. He watched reruns. He yawned. It was pretty boring to just sit in a chair all day, but he wanted the chairâs last hours to be full of farts and ass stink.
The clock eventually struck 3:30pm. Only 30 more minutes. The chair had done a fantastic job today. Unlike yesterday with all of its shaking around and moaning and speaking, the chair was completely quiet, and barely moved. It didnât matter how loud or long or rank the farts were, the chair silently took them in. Again, as Johnâs heart was pounding, he pulled his pants down and sat back on the chair with his bare ass. He felt the tongue wiggle up his hole immediately. He started to jerk off, his throbbing cock large in his hand. His balls felt swollen. He knew he was going to cum soon, so he had to make it count.
He tried imagining what it was like for his chair the past two days. How endless the assault of farts must have been for its nose. How uncomfortable its body had to be in the straps. How it had no way of knowing the passage of time, and could only see, feel, and smell the ass that was resting on it. How bad his ass stunk from the farts and from not washing. And how the chair licked his asshole without protest.
He felt a fart and ripped it onto the tongue and into its mouth.
PRRRR
The tongue recoiled for a moment, then kept going.
John came. His asshole clenched over the tongue that was rimming him.
He settled down, his heart beating, and feeling light headed, as the tongue kept probing his asshole. The clock read 4pm, but he spent a few minutes relaxing in the afterglow.
âAlright then,â John sighed in disappointment, âTimeâs up.â
He stood up. Ben let out a sigh of relief. John lowered the gurnee, and moved the chair out of the way. Then, he pulled the gurnee halfway out. He undid the hoses and tubes around Benâs privates. Then he pulled the gurnee out. Ben looked pale, limp, and miserable. Especially in his eyes, there was such misery and exhaustion. His cock was rock hard.
âI donât normally do this to guys,â John said, âBut you deserve a reward for being such a good chair,â
He dropped his pants, and straddled Ben, lowering his asshole over his face, smothering him. As he sat on Ben, he watched as his body buckled around. John grabbed Benâs rock hard cock, bent over, and took it into his mouth.
Ben had been rock hard for so long, that he felt his dick was sensitive enough to go off at the slightest friction. At least, thatâs what he thought would happen, if he had any physical stimulation while he was down there. It only took him a minute to erupt cum into Johnâs mouth. He moaned into Johnâs ass.
Then, John stood up and undid the straps. Slowly, Ben moved his joints around. When John got to the headboard and undid the strap and posts, Ben cracked his neck loudly. Like a sloth, he tried sitting up, his full body was fatigued. Red lines from where the straps were raced across his skin.
âWell...how was it?â John smiled.
âThat was fucking horrible,â Ben muttered.
âOh,â John frowned, âIâm sorry it wasnât what you hoped it would be.â
âFuck off, whereâs your bathroom, I need to shower.â
âŚ
John drove him to the train station that evening. In the car, just before Ben left, he said âWell, even though you didnât like it, thanks for helping me live out this fantasy.â
âWhatever,â Benâs voice was low. He got out of the car and headed for the train.
âŚ
On the train ride, Ben looked depressed. He thought through everything heâd experienced. How badly Johnâs farts stink. How uncomfortable it was to be strapped down. How humiliating and disgusting it was to relieve himself in a hole in the wall. His full body was exhausted and stiff with pain from laying on the board for so long. And John didnât even have the decency to let him stretch once. He remembered how boring it was to just lay there quietly, passively taking farts to the face, and then staring up at the ceiling when he was away. He had constant headaches from exhaustion and the pressure of Johnâs body. He felt underfed and cranky from the small bland meals John made for him. And worst of all, he was constantly nauseous when John farted into his nose. His throat hurt from so much coughing and gagging. And when the farts were very bad, he would jerk around and the straps dug more into his skin, making it burn.
Heâd turned down going with his friends to a bar that weekend for this. Heâd chosen to spend two days of his life like this. He felt so dirty and pathetic. And embarrassed. He had been so excited to try out bondage, and his fart fetish, only to hate both in the end.
That night, he was laying in bed, and he thought about Johnâs ass, how bad it stunk, how gross it felt sweating on his face, how the hairs clung to his nose and made it itch.
Despite how much heâd hated the experience, his cock was rock hard. And cocks usually donât lie.
He called John.
âHello?â
âHey John, itâs me. Ben.â
âOh...hey. Whatâs up?â
He took a deep breath, âThat was the hottest thing Iâve ever done. I loved it so much.â
âReally? You sounded so mad after I let you out,â
âYeah butâŚâ Ben couldnât explain, âI canât stop thinking about your asshole.â
âOh well Iâm flattered, haha,â
âAre you doing anything this weekend?â
On the other end of the line, Ben heard John laughing.
(Contains hypno if you're into that)
Ugh doing interviews is such a pain. The recent promotion was worth it for the pay rise but didn't make the job hiring any more fun. Luckily this was the last one of the day. You ordered your new secretary to send the final guy into your new office and you sat back in your clean new chair feeling happy with yourself.
You heard the door open and you didn't even want to look up.
"Hey, take a seat, I'm just finishing something." You dragged your mouse around pretending to do anything just to set up a power dynamic.
"Ah well I have places to be." You registered the snide retort as you heard him sit down. You looked up at the other guy staring back at you. He seemed familiar but you couldn't place it.
"Do I know you?" You bluntly questioned.
The guy smirked. "Yeah we were in high school together, don't think you were a big fan though." You stared back at this confrontational guy and picked up on his well groomed appearance. Oh shit he was that gay kid, yeah you kinda bullied him a bit but damn that was years ago.
"Ah well we're adults now," you tried to take a professional tone, "so you're looking for a job here?" You weren't in the mood for apologies.
"Oh wait before that." He cut you off before you could elaborate adjusting his position in his chair crossing one leg onto the other and lifting his butt up a little.
PPPPPPRRRRRRAFFFFFFTTT
The undeniable sound of a fart blew out into the chair and diffused into around the room.
"Phew that was a stinker!" He relaxed back into his chair taking a big sniff. So much for professional you thought covering your nose with a handkerchief. This didn't do much however as you'd already gotten a noseful of the interviewees cheesey stink.
"Not making a great first impression here." You condescendingly raised your eyebrows at the smug looking man.
"Are you sure, I think the stink is gonna go down a storm." He winked as he lifted up his ass again making you grimace.
BBBBBBRRRAAAPPPPPTTTTTTTTT
"Whew gotta love it!" The man took another inhale of the putrid smell which was tainting your once fresh office. You unfortunately got another whiff yourself and the rotten smell even got in your mouth making you wretch.
"What kind of weird revenge, I'm calling securi-"
"Nuh uh!" He got up cutting off your threat and bent over pointing his ass right over your desk.
FFFFFFFFRRRRRRRARRRRRRPPPPPPPPPPP
The blast blew your hair back and it was the worst smell yet making you gag and unluckily breathe in a massive amount of flatulence. And just then your body began to feel sluggish.
He leered back over his stinky ass at your plain expression. "Ah third time's the charm." He chuckled.
You willed you arm to reach for the phone but your body wouldn't move. Your mind was racing but you had lost all control of your physical being. Your former classmate was now sitting on the desk ass pointing at you as he smiled down at you.
Pssssssssshhhhhhhhhhhhhhhh
The hot quiet rush of stink was aimed directly at you forcing you to suffer in silence unable to hold your breathe. "Ah when you torment people in high school I assume you never take into account mind-controlling farts but here we are?" He laughed down at you. You could tell he could see the suffering in your eyes based on his malicious gaze. "Whew and such a toxic brew as well!" He wafted the seemingly never ending SBD in your direction while leaning over to get a good sniff himself.
He stood up finally cutting off the fart. It seemed like your office was now hazy from the rancid smell permeating every corner. "Okay let's switch seats, its my turn to interview!" He playfully smiled as he watched you pull yourself up and walk over to the other side of the desk and sit on the polluted chair. It was a horrific sensation, you could still experience every sense perfectly, unfortunately smell included, but you were in control of none of them. You moved as you normally would but it wasn't you doing it, it was like someone was playing you in a game.
"Yeah it is scary, but you deserve it." He broke his playful tone giving you a much more serious look. Could he read your mind or was your fear just that obvious. "And no I can't read your mind, fart sniffing slaves like you are just easy to read." You wished it would wear off but no matter how much you willed it you weren't moving.
"Your company posting your promotion really was a death sentence for you." He sneered at your mournful eyes. "Which is why I've got an even better position for you." He reverted back to his maliciously playful tone. "So first your gonna walk out of here and say that you're quitting from the stress, then you're going to call your family and say that you've always been gay and you're moving far away to live with the man of your dreams." As he began to give the orders your eyes trembled. What kind of hell was this? Could he really make you do all that? "But of course that's not true, after selling all your assets and transferring them to me you'll need something to do!" He grinned evilly, your heart was sinking so deep it felt almost as painful as your stinging eyes and intoxicated lungs. "So since your face looks so comfortable I think you'll serve a much better purpose in this world as my fart cushion!" He seemed ecstatic to inform you of your fate while you wished for this nightmare to be over. "Any of my foul fragrance which I think needs a second set of nostrils to appreciate will be yours to sniff." He rubbed his stomach. "So how about a trial shift to finish this interview?"
He stood up once more and turned around. "So you want the job?" Everything inside you was saying no but the potent pheremones controlling you thought otherwise.
"Of course!" Your voice replied eagerly and your face twisted into a subservient smile as your body climbed over the desk and you nestled your nose between his tightly covered cheeks. This was when the level of control he had over you sunk in. This was real. The maniacal laughter coming from your new boss solidified it.
"Ah don't worry the first day on the job always stinks!"
BBBBBBBBBBRRRRRRRRRRAAAAAAPPPPPPPPPPPPPPPPPPTTTTTTTT
-
ko-fi if you wanna tip or make a commission